From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2291 [new locus tag: NWMN_RS13180 ]
  • pan locus tag?: SAUPAN005922000
  • symbol: NWMN_2291
  • pan gene symbol?: nreC
  • synonym:
  • product: transcriptional regulator DegU family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2291 [new locus tag: NWMN_RS13180 ]
  • symbol: NWMN_2291
  • product: transcriptional regulator DegU family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2516730..2517383
  • length: 654
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    TTGAAAATAGTCATTGCCGATGATCACGCTGTTGTCCGTACGGGGTTCTCTATGATTTTA
    AATTATCAAAATGATATGGAAGTTGTTGCAACGGCTGCAGATGGCGTCGAAGCTTACCAA
    AAAGTAATGGAATATAAACCTGATGTGTTACTAATGGATTTAAGTATGCCACCAGGTGAG
    TCAGGTCTTATCGCTACGAGTAAAATTGCTGACAGTTTTCCTGAAACTAAAATACTAATA
    TTAACAATGTTTGATGATGAGGAGTATTTGTTCCATGTGTTGCGTAATGGTGCGAAAGGT
    TACATATTGAAAAATGCACCTGATGAACAATTATTGTTAGCTATTCGAACTGTATATAAA
    GGTGAAACATATGTAGATATGAAACTTACAACATCTTTAGTGAATGAATTTGTATCTAAT
    TCAAATCAGGACACTGCAAACACAACAGATCCTTTTAAAATCTTATCAAAACGAGAACTA
    GAAATATTGCCACTTATTGCCAAAGGTTACGGGAATAAAGAAATTGCAGAGAAATTATTT
    GTATCTGTGAAAACAGTAGAAGCACATAAGACGCATATTATGACAAAGCTTGGCTTAAAG
    AGTAAACCTGAGCTAGTTGAATATGCATTGAAAAAGAAATTATTAGAGTTTTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    654

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2291 [new locus tag: NWMN_RS13180 ]
  • symbol: NWMN_2291
  • description: transcriptional regulator DegU family protein
  • length: 217
  • theoretical pI: 5.39357
  • theoretical MW: 24368.2
  • GRAVY: -0.0778802

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 55)
    and 13 more
    LuxR family transcriptional regulatory, chaperone HchA-associated (TIGR03541; HMM-score: 39)
    transcriptional regulator EpsA (TIGR03020; HMM-score: 37.5)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 35.8)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 35.6)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 31.7)
    RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24.5)
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 23.5)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 21.7)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 18.8)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 11.2)
  • TheSEED:  
    response regulator
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 88.1)
    HTH (CL0123) GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 78.1)
    and 6 more
    Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 19.4)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.5)
    DUF2089; Protein of unknown function (DUF2089) (PF09862; HMM-score: 14.3)
    Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 14)
    Pilus (CL0327) Pilin_PilX; Minor type IV pilin, PilX (PF11530; HMM-score: 12.9)
    HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 11.9)

Structure, modifications & interactions[edit | edit source]

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010951
    • TAT(Tat/SPI): 0.000349
    • LIPO(Sec/SPII): 0.000503
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKIVIADDHAVVRTGFSMILNYQNDMEVVATAADGVEAYQKVMEYKPDVLLMDLSMPPGESGLIATSKIADSFPETKILILTMFDDEEYLFHVLRNGAKGYILKNAPDEQLLLAIRTVYKGETYVDMKLTTSLVNEFVSNSNQDTANTTDPFKILSKRELEILPLIAKGYGNKEIAEKLFVSVKTVEAHKTHIMTKLGLKSKPELVEYALKKKLLEF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: NreC* (activation) regulon
    NreC(TF)important in Nitrate and nitrite respiration; RegPrecise    transcription unit transferred from N315 data RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]