From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2590 [new locus tag: NWMN_RS14850 ]
  • pan locus tag?: SAUPAN006449000
  • symbol: NWMN_2590
  • pan gene symbol?: —
  • synonym:
  • product: transcriptional regulator PadR-like family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2590 [new locus tag: NWMN_RS14850 ]
  • symbol: NWMN_2590
  • product: transcriptional regulator PadR-like family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2857631..2857969
  • length: 339
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTCAGTGTCAGATCAGATTATGAAAGGTCTCTTAGATGGGGCGATATTAGGTCTCATT
    GCCCAAGGCGAAACGTATGGATATGAAATTATGACGAAACTTAAGAATCAAGAGTTTCCA
    GAGATAAGTGAGGGTAGTATTTATCCAGTTTTAATGCGTTTAAACAAAAAAGGATACGTT
    GATACGACAATAAAAAAATCTAGTAATGGCGGCCCGAGGCGGAAATACTATACGATTACC
    GATTCAGGTTTAAAGGAACTAAAAGTATTTAAATCGAAATGGCAAGTTTTGAATAAAGGG
    ATGATTAACTTGTTTGGAGGGGAAAACGATGTTAAGTAA
    60
    120
    180
    240
    300
    339

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: NWMN_2590 [new locus tag: NWMN_RS14850 ]
  • symbol: NWMN_2590
  • description: transcriptional regulator PadR-like family protein
  • length: 112
  • theoretical pI: 9.92297
  • theoretical MW: 12556.5
  • GRAVY: -0.405357

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 60)
    and 2 more
    Signal transduction Regulatory functions DNA interactions poly-beta-hydroxybutyrate-responsive repressor (TIGR02719; HMM-score: 30.4)
    Signal transduction Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 12)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    HTH (CL0123) PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 82.2)
    and 4 more
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 22.3)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.3)
    Replic_Relax; Replication-relaxation (PF13814; HMM-score: 14.2)
    FUR; Ferric uptake regulator family (PF01475; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.036252
    • TAT(Tat/SPI): 0.009143
    • LIPO(Sec/SPII): 0.008957
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYVDTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQVLNKGMINLFGGENDVK

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=NWMN_2590&oldid=73881"