Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2484 [new locus tag: SA_RS14210 ]
- pan locus tag?: SAUPAN006449000
- symbol: SA2484
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2484 [new locus tag: SA_RS14210 ]
- symbol: SA2484
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2795305..2795643
- length: 339
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125414 NCBI
- RefSeq: NP_375811 NCBI
- BioCyc: see SA_RS14210
- MicrobesOnline: 104837 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTCAGTGTCAGATCAGATTATGAAAGGTCTCTTAGATGGGGCGATATTAGGTCTCATT
GCCCAAGGCGAAACGTATGGATATGAAATTATGACGAAACTTAAGAATCAAGAGTTTCCA
GAGATAAGTGAGGGTAGTATTTATCCAGTTTTAATGCGTTTAAACAAAAAAGGATACGTT
GATACGACAATAAAAAAATCTAGTAATGGCGGCCCGAGGCGGAAATACTATACGATTACC
GATTCAGGTTTAAAGGAACTAAAAGTATTTAAATCAAAATGGCAAGCTTTGAATAAAGGG
ATGATTAACTTGTTTGGAGGGGAAAACGATGTTAACTAA60
120
180
240
300
339
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2484 [new locus tag: SA_RS14210 ]
- symbol: SA2484
- description: hypothetical protein
- length: 112
- theoretical pI: 9.77653
- theoretical MW: 12514.4
- GRAVY: -0.423214
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 60.9)and 2 moreRegulatory functions DNA interactions poly-beta-hydroxybutyrate-responsive repressor (TIGR02719; HMM-score: 30.7)Regulatory functions DNA interactions phenylacetic acid degradation operon negative regulatory protein PaaX (TIGR02277; HMM-score: 12.1)
- TheSEED :
- Transcriptional regulator, PadR family
- PFAM: HTH (CL0123) PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 83.2)and 8 moreHTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 16.6)MCM_C; MCM protein C-terminal winged helix-turn-helix domain (PF21100; HMM-score: 13.9)FUR; Ferric uptake regulator family (PF01475; HMM-score: 12.6)no clan defined DUF6429; Domain of unknown function (DUF6429) (PF20008; HMM-score: 12.4)HTH (CL0123) HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 12.2)Replic_Relax; Replication-relaxation (PF13814; HMM-score: 12.2)LexA_DNA_bind; LexA DNA binding domain (PF01726; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9884
- Cytoplasmic Membrane Score: 0.0033
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0073
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.036252
- TAT(Tat/SPI): 0.009143
- LIPO(Sec/SPII): 0.008957
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSVSDQIMKGLLDGAILGLIAQGETYGYEIMTKLKNQEFPEISEGSIYPVLMRLNKKGYVDTTIKKSSNGGPRRKYYTITDSGLKELKVFKSKWQALNKGMINLFGGENDVN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]