Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS01500 [old locus tag: NWMN_0269 ]
- pan locus tag?: SAUPAN000546000
- symbol: NWMN_RS01500
- pan gene symbol?: —
- synonym:
- product: helix-turn-helix domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS01500 [old locus tag: NWMN_0269 ]
- symbol: NWMN_RS01500
- product: helix-turn-helix domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 326313..326576
- length: 264
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCCAAAAATCATAGTACCACCAACACCAGAAAACACATATAGAGGCGAAGAAAAATTT
GTGAAAAAGTTATACGCAACACCTACACAAATCCATCAATTGTTTGGAGTATGTAGAAGT
ACAGTATACAACTGGTTGAAATATTACCGCAAAGATAATTTAGGTGTAGAAAATTTATAC
ATTGATTATTCACCAACAGGCACTCTGATTAATATTTCTAAATTGGAAGAGTATTTGATC
AGAAAGCATAAAAAATGGTATTAG60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS01500 [old locus tag: NWMN_0269 ]
- symbol: NWMN_RS01500
- description: helix-turn-helix domain-containing protein
- length: 87
- theoretical pI: 9.82716
- theoretical MW: 10444.1
- GRAVY: -0.611494
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see NWMN_0269
- PFAM: HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 30.7)and 9 moreHTH_29; Winged helix-turn helix (PF13551; HMM-score: 21)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 20.2)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 19)HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 17)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16.6)HTH_OrfB_IS605; Helix-turn-helix domain (PF12323; HMM-score: 16)no clan defined DUF6570; Domain of unknown function (DUF6570) (PF20209; HMM-score: 16)HTH (CL0123) CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 14.9)no clan defined Xre-MbcA-ParS_M; Antitoxin Xre/MbcA/ParS-like, middle domain (PF23125; HMM-score: 13.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9387
- Cytoplasmic Membrane Score: 0.0138
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.046
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009984
- TAT(Tat/SPI): 0.000407
- LIPO(Sec/SPII): 0.001073
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYRKDNLGVENLYIDYSPTGTLINISKLEEYLIRKHKKWY
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]