From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS01650 [old locus tag: NWMN_0288 ]
  • pan locus tag?: SAUPAN000560000
  • symbol: NWMN_RS01650
  • pan gene symbol?:
  • synonym:
  • product: terminase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS01650 [old locus tag: NWMN_0288 ]
  • symbol: NWMN_RS01650
  • product: terminase
  • replicon: chromosome
  • strand: +
  • coordinates: 338083..338577
  • length: 495
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (338083..338577) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    TTGATTAAATTAACACCGAAGCAAGAAAAGTTTGTGCTAGGACTCATAGAGGGCAAGAGC
    CAACGGAAAGCATATATTGACGCAGGGTATTCGACTAAAGGTAAGAGTGGGGAATATCTA
    GATAAAGAAGCGAGTACACTTTTTAAAAATCGGAAGGTTTCCGGAAGGTACGAAAAATTG
    CGTCAAGAAGTAGCTGAACAATCAAAATGGACACGCCAAAAGGCCTTTGAAGAATATGAG
    TGGCTAAAGAATGTAGCTAAGAATGACATTGAAATAGAGGGAGTGAAGAAAGCGACAGCT
    GATGCATTCCTCGCTAGTTTAGATGGTATGAATAGAATGACGTTAGGTAACGAAGTTTTA
    GCTAACAAGAAAATAGAAACTGAAATTAAGATGCTTGAGAAGAAGATTGAACAAATAGAT
    AAAGGTGACAGTGGAACAGAAGATAAAATCAAACAACTTCACGACGCAATAACGGAAGTG
    ATCGTCAATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    495

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS01650 [old locus tag: NWMN_0288 ]
  • symbol: NWMN_RS01650
  • description: terminase
  • length: 164
  • theoretical pI: 9.20965
  • theoretical MW: 18718.3
  • GRAVY: -0.779268

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein folding and stabilization prefoldin, alpha subunit (TIGR00293; HMM-score: 20.3)
  • TheSEED:
  • PFAM:
    no clan defined Terminase_2; Terminase small subunit (PF03592; HMM-score: 38)
    and 3 more
    Prefoldin (CL0200) Prefoldin; Prefoldin subunit (PF02996; HMM-score: 16.3)
    no clan defined XhlA; Haemolysin XhlA (PF10779; HMM-score: 14.8)
    FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 14.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.029586
    • TAT(Tat/SPI): 0.001487
    • LIPO(Sec/SPII): 0.005082
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446516742 NCBI
  • RefSeq: WP_000594088 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIKLTPKQEKFVLGLIEGKSQRKAYIDAGYSTKGKSGEYLDKEASTLFKNRKVSGRYEKLRQEVAEQSKWTRQKAFEEYEWLKNVAKNDIEIEGVKKATADAFLASLDGMNRMTLGNEVLANKKIETEIKMLEKKIEQIDKGDSGTEDKIKQLHDAITEVIVNE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]