Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS02170 [old locus tag: NWMN_0384 ]
- pan locus tag?: SAUPAN002057000
- symbol: NWMN_RS02170
- pan gene symbol?: —
- synonym:
- product: transposase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS02170 [old locus tag: NWMN_0384 ]
- symbol: NWMN_RS02170
- product: transposase
- replicon: chromosome
- strand: -
- coordinates: 433128..433400
- length: 273
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACAAAAGAAAGAAGAACATTTAGTTCAGAGTTTAAGTTACAAATGGTTAGATTATAT
AAAAATGGTAAGCTTAAGAATGAAATTATACGAAAGTATGATTTAAAACCCTCAATTATC
TCAAATTCGATAAAACAACACCAAAATACTGGACCCTTCAATCATCAAGATAATTTAAAA
AGTGATGAAAAAGAGTTAATAAAATTACGCAAAGAAGTTCAACATTTAAAAATGGAACAT
GATGTTTTAAAGCAAATTTTAAAGTTGATTTAG60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS02170 [old locus tag: NWMN_0384 ]
- symbol: NWMN_RS02170
- description: transposase
- length: 90
- theoretical pI: 10.6672
- theoretical MW: 10830.6
- GRAVY: -0.925556
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see NWMN_0384
- PFAM: HTH (CL0123) HTH_Tnp_1; Transposase (PF01527; HMM-score: 30.4)and 7 moreHTH_28; Helix-turn-helix domain (PF13518; HMM-score: 18)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 15.9)no clan defined DUF7491; Coiled-coil region of unknown function (DUF7491) (PF24319; HMM-score: 15.6)YqfI; YqfI-like (PF23690; HMM-score: 14.3)REST_helical; Helical region in REST corepressor (PF20878; HMM-score: 13.9)DUF7237; Family of unknown function (DUF7237) (PF23884; HMM-score: 13.3)HTH (CL0123) BrkDBD; Brinker DNA-binding domain (PF09607; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.73
- Cytoplasmic Membrane Score: 0.0164
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.253
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004697
- TAT(Tat/SPI): 0.000704
- LIPO(Sec/SPII): 0.001941
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGPFNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]