Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS02900 [old locus tag: NWMN_0497 ]
- pan locus tag?: SAUPAN002304000
- symbol: NWMN_RS02900
- pan gene symbol?: secE
- synonym:
- product: protein translocase subunit SecE
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS02900 [old locus tag: NWMN_0497 ]
- symbol: NWMN_RS02900
- product: protein translocase subunit SecE
- replicon: chromosome
- strand: +
- coordinates: 571650..571832
- length: 183
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGCTAAAAAAGAAAGTTTCTTTAAAGGCGTTAAGTCTGAAATGGAAAAAACAAGTTGG
CCGACGAAAGAAGAGCTATTTAAATATACTGTAATTGTAGTTTCTACTGTTATATTCTTC
TTAGTCTTTTTCTATGCCTTAGATTTAGGAATTACAGCATTGAAAAATTTATTATTTCGT
TAG60
120
180
183
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS02900 [old locus tag: NWMN_0497 ]
- symbol: NWMN_RS02900
- description: protein translocase subunit SecE
- length: 60
- theoretical pI: 10.0161
- theoretical MW: 7031.36
- GRAVY: 0.401667
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecE subunit (TIGR00964; HMM-score: 75.8)and 1 moreHAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 11.8)
- TheSEED: see NWMN_0497
- PFAM: no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 70)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.998
- Cell wall & surface Score: 0
- Extracellular Score: 0.002
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003795
- TAT(Tat/SPI): 0.000127
- LIPO(Sec/SPII): 0.001823
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]