From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS03395 [old locus tag: NWMN_0595 ]
  • pan locus tag?: SAUPAN002496000
  • symbol: NWMN_RS03395
  • pan gene symbol?: mnhC2
  • synonym:
  • product: cation:proton antiporter

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS03395 [old locus tag: NWMN_0595 ]
  • symbol: NWMN_RS03395
  • product: cation:proton antiporter
  • replicon: chromosome
  • strand: +
  • coordinates: 675305..675649
  • length: 345
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (675305..675649) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATTTAATATTATTACTAGTTATAGGATTTTTAGTGTTTATAGGAACATATATGATT
    TTATCAATCAATTTAATTCGTATTGTAATCGGAATTTCAATATATACTCATGCTGGTAAT
    CTCATTATTATGAGTATGGGAACGTATGGTTCTAGTAGATCAGAACCACTAATAACTGGT
    GGAAACCAATTGTTTGTTGATCCCTTGTTACAAGCTATTGTACTAACTGCAATAGTTATA
    GGGTTTGGGATGACTGCGTTTTTACTTGTACTTGTTTATAGAACTTATAAAGTAACAAAA
    GAAGATGAAATTGAAGGCCTAAGGGGGGAAGATGATGCTAAGTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS03395 [old locus tag: NWMN_0595 ]
  • symbol: NWMN_RS03395
  • description: cation:proton antiporter
  • length: 114
  • theoretical pI: 4.93178
  • theoretical MW: 12495.9
  • GRAVY: 0.886842

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 99.1)
  • TheSEED:
  • PFAM:
    no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 95)
    and 2 more
    Ost4; Oligosaccaryltransferase (PF10215; HMM-score: 16.2)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.040897
    • TAT(Tat/SPI): 0.000516
    • LIPO(Sec/SPII): 0.004452
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI: 446971729 NCBI
  • RefSeq: WP_001048985 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]