Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS03730 [old locus tag: NWMN_0658 ]
- pan locus tag?: SAUPAN002573000
- symbol: NWMN_RS03730
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS03730 [old locus tag: NWMN_0658 ]
- symbol: NWMN_RS03730
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 739399..739686
- length: 288
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACAAACGAAGATAAACGTTTCGAACAATTAAGATTTGAACGCAAATTTATAGTTATT
CCGTATTTAATTTATGCAGTCATTGTATTACTATTAAATATTTTCTATTCTGATTTGAAA
ATAACAATGACATTATTCGGACTTTTCTTTGCGTATAATGTAGTCATTTTGTTCATAGCA
TTTGTTAAACATTATAAACGCACATTGTTACTAAGTCTTATATTAACAGTGCTTAGTGGC
GCGGCATTCTTTGGAATTATTTATGTTTATGGCATTAATCATTTTTAA60
120
180
240
288
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS03730 [old locus tag: NWMN_0658 ]
- symbol: NWMN_RS03730
- description: hypothetical protein
- length: 95
- theoretical pI: 9.85429
- theoretical MW: 11226.5
- GRAVY: 0.988421
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see NWMN_0658
- PFAM: no clan defined DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 12.6)PIG-F; GPI biosynthesis protein family Pig-F (PF06699; HMM-score: 10.1)and 3 moreDUF6404; Family of unknown function (DUF6404) (PF19942; HMM-score: 9.2)DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.6)Hybrid (CL0105) DUF2254; Predicted membrane protein (DUF2254) (PF10011; HMM-score: 5.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9969
- Cell wall & surface Score: 0
- Extracellular Score: 0.003
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000787
- TAT(Tat/SPI): 0.000168
- LIPO(Sec/SPII): 0.012465
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTNEDKRFEQLRFERKFIVIPYLIYAVIVLLLNIFYSDLKITMTLFGLFFAYNVVILFIAFVKHYKRTLLLSLILTVLSGAAFFGIIYVYGINHF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.