Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS04565 [old locus tag: NWMN_0807 ]
- pan locus tag?: SAUPAN003035000
- symbol: NWMN_RS04565
- pan gene symbol?: nfu
- synonym:
- product: NifU family protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS04565 [old locus tag: NWMN_0807 ]
- symbol: NWMN_RS04565
- product: NifU family protein
- replicon: chromosome
- strand: -
- coordinates: 895422..895664
- length: 243
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGCCTACTGAAGATACAACGATGTTTGATCAAGTAGCAGAAGTTATTGAACGTCTTCGT
CCATTTTTATTACGTGATGGTGGCGACTGCTCATTGATTGACGTGGAAGACGGTATTGTT
AAATTACAATTACATGGTGCATGTGGTACATGCCCAAGTTCTACAATCACTCTTAAAGCT
GGTATTGAGCGTGCATTACACGAAGAAGTGCCTGGTGTAATAGAAGTAGAACAAGTATTC
TAA60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS04565 [old locus tag: NWMN_0807 ]
- symbol: NWMN_RS04565
- description: NifU family protein
- length: 80
- theoretical pI: 4.10599
- theoretical MW: 8740.95
- GRAVY: 0.08625
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Other Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 57.2)Central intermediary metabolism Nitrogen fixation Fe-S cluster assembly protein NifU (TIGR02000; HMM-score: 57.2)and 1 moreBiosynthesis of cofactors, prosthetic groups, and carriers Other IscR-regulated protein YhgI (TIGR03341; HMM-score: 40)
- TheSEED: see NWMN_0807
- PFAM: NifU (CL0232) NifU; NifU-like domain (PF01106; HMM-score: 93.5)and 2 moreFeS_assembly_P; Iron-sulfur cluster assembly protein (PF01883; HMM-score: 14.7)Gal_mutarotase (CL0103) DUF4432; Domain of unknown function (DUF4432) (PF14486; HMM-score: 10.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9961
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0
- Extracellular Score: 0.0024
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.04606
- TAT(Tat/SPI): 0.010062
- LIPO(Sec/SPII): 0.000738
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MPTEDTTMFDQVAEVIERLRPFLLRDGGDCSLIDVEDGIVKLQLHGACGTCPSSTITLKAGIERALHEEVPGVIEVEQVF
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]