PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus Newman
• locus tag: NWMN_RS05060 [old locus tag: NWMN_0903 ]
• pan locus tag^?: SAUPAN003225000
• symbol: NWMN_RS05060
• pan gene symbol^?: —
• synonym:
• product: ABC transporter ATP-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: NWMN_RS05060 [old locus tag: NWMN_0903 ]
• symbol: NWMN_RS05060
• product: ABC transporter ATP-binding protein
• replicon: chromosome
• strand: +
• coordinates: 1002398..1003039
• length: 642
• essential: unknown other strains

⊟Accession numbers

• Location: NC_009641 (1002398..1003039) NCBI
• BioCyc:
• MicrobesOnline: see NWMN_0903

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  
  ATGATAGAATTAAAAGATTTAACCATACAAAAAGGTAATACACATATTTTGAAGAAACTT
  AATTTGAAATTTCAATGTGGAAAATCATATGCACTTATTGGTAAAAGTGGATGCGGTAAA
  TCTACATTATTAAATACTATTGCTGGACTTGAAAAAACAGGAAAACAATATGTCTATTTT
  AATGGTCAATTAGAACAATTTAAATCTAATTTTTACAGAGATAAATTAGGATATTTATTT
  CAAAATTATGGATTAATCGATAATTTGACAGTAAATGAAAATTTAGATATTGGATTAGCA
  TATAAAAAAATAAGTAAGAAAGAAAAAGAACAAATAAAGATACGTTATATAGAACAGTTT
  GGTCTGTCAAACAGTTTAAAAAGAAAAGTTCATACGCTAAGTGGAGGTGAACAACAACGT
  GTCGCTTTAATTAGAATGATGTTAAAAGATCCGATTGTTATGTTAGCTGATGAACCAACG
  GGTGCGTTAGATCCTAAAACAGGACAGATGATTATTCAATCATTATTTGGTTTGGTCGAT
  GAAAATAAAGTGCTGATTTTAGCAACACATGATATGGCTATTGCAAATCAATGTGACGAA
  ATAATAGATTTAGAACAGTATAGAAAAGTAGCATCTATGTGA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  642
  

⊟Protein

⊟General

• locus tag: NWMN_RS05060 [old locus tag: NWMN_0903 ]
• symbol: NWMN_RS05060
• description: ABC transporter ATP-binding protein
• length: 213
• theoretical pI: 9.562
• theoretical MW: 24113
• GRAVY: -0.26338

⊟Function

• TIGRFAM:
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 267.3)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 267.3)
  and 78 more
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 142.9)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 140.1)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 134.7)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 133.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 129.1)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 128.4)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 127.4)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 115.8)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 112.7)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 112.7)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 111.7)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 111.4)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 111.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 111)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 111)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 110)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 109.8)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 107.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 105.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 105.2)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 104.7)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 104.7)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 104.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 104.1)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 102.4)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 102.3)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 96.9)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 95.6)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 95)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 93.7)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 93.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 92.8)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 91.1)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 88.3)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 88.3)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 86.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 86.3)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.1)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 86.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 84.4)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 83.3)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 83.2)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 83.2)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 82.5)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 82.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 81.5)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.4)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.4)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 81.4)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 80.4)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 79.5)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 78.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 76.4)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 75.6)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 75.5)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 64.3)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 61)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 60.7)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 59.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 53.9)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 51.5)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 51.3)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.9)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.7)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.7)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 46.6)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 46.4)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 42.7)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 39.3)
  Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 18.5)
  Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 16.2)
  Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 15.7)
  Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 15.5)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 15.4)
  restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 15.1)
  Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 14.2)
  Metabolism Energy metabolism Amino acids and amines ethanolamine utilization protein, EutP (TIGR02528; HMM-score: 13.8)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 10.9)
• TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 110.4)
  and 21 more
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 29.8)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 25)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 24.6)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 22.1)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 20.1)
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 18.6)
  AAA_14; AAA domain (PF13173; HMM-score: 18.4)
  MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 16.9)
  NACHT; NACHT domain (PF05729; HMM-score: 16.8)
  AAA_15; AAA ATPase domain (PF13175; HMM-score: 16.5)
  RNA_helicase; RNA helicase (PF00910; HMM-score: 16.3)
  FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 15.1)
  AAA_22; AAA domain (PF13401; HMM-score: 15)
  G-alpha; G-protein alpha subunit (PF00503; HMM-score: 14.2)
  AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 14.1)
  DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 13.1)
  PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 12.8)
  SbcCD_C; Putative exonuclease SbcCD, C subunit (PF13558; HMM-score: 12.4)
  AAA_24; AAA domain (PF13479; HMM-score: 12.3)
  ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 11.7)
  AAA_23; AAA domain (PF13476; HMM-score: 10.1)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.01
  • Cytoplasmic Membrane Score: 9.99
  • Cellwall Score: 0
  • Extracellular Score: 0
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.139368
  • TAT(Tat/SPI): 0.002686
  • LIPO(Sec/SPII): 0.056803
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446493324 NCBI
• RefSeq: WP_000571178 NCBI
• UniProt: see NWMN_0903

⊟Protein sequence

• MIELKDLTIQKGNTHILKKLNLKFQCGKSYALIGKSGCGKSTLLNTIAGLEKTGKQYVYFNGQLEQFKSNFYRDKLGYLFQNYGLIDNLTVNENLDIGLAYKKISKKEKEQIKIRYIEQFGLSNSLKRKVHTLSGGEQQRVALIRMMLKDPIVMLADEPTGALDPKTGQMIIQSLFGLVDENKVLILATHDMAIANQCDEIIDLEQYRKVASM

⊟Experimental data

• experimentally validated:
• protein localization: data available for COL
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications