From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
  • pan locus tag?: SAUPAN003305000
  • symbol: NWMN_RS05330
  • pan gene symbol?:
  • synonym: nrdH
  • product: NrdH-redoxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
  • symbol: NWMN_RS05330
  • product: NrdH-redoxin
  • replicon: chromosome
  • strand: -
  • coordinates: 1057056..1057289
  • length: 234
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1057056..1057289) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0951

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCAGAAATAATCGTTTATACGCAGAATGATTGTCCACCTTGTACATTTGTAAAAAAT
    TATCTAAATGAGCATCACATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGA
    AACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGCAATCCA
    ATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA
    60
    120
    180
    234

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
  • symbol: NWMN_RS05330
  • description: NrdH-redoxin
  • length: 77
  • theoretical pI: 4.09175
  • theoretical MW: 9196.21
  • GRAVY: -0.542857

Function[edit | edit source]

  • TIGRFAM:
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 45.3)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 36.7)
    and 6 more
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 29.4)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 23.4)
    glutaredoxin-family domain (TIGR02190; HMM-score: 19.2)
    glutaredoxin-like protein (TIGR02200; HMM-score: 18.9)
    glutaredoxin (TIGR02180; HMM-score: 16.5)
    Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 12.8)
  • TheSEED: see NWMN_0951
  • PFAM:
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 39.4)
    and 2 more
    GST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 19.4)
    Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 17.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9873
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0118
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002124
    • TAT(Tat/SPI): 0.000083
    • LIPO(Sec/SPII): 0.000549
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]