Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
- pan locus tag?: SAUPAN003305000
- symbol: NWMN_RS05330
- pan gene symbol?: —
- synonym: nrdH
- product: NrdH-redoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
- symbol: NWMN_RS05330
- product: NrdH-redoxin
- replicon: chromosome
- strand: -
- coordinates: 1057056..1057289
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTCAGAAATAATCGTTTATACGCAGAATGATTGTCCACCTTGTACATTTGTAAAAAAT
TATCTAAATGAGCATCACATTGATTTTGAAGAGAGAAATATCAACAATCAACAATATCGA
AACGAAATGATAGATTTTGATGCTTTTTCAACTCCGTTTATTTTGTTGAATGGCAATCCA
ATGTACCATGTTGATCTTGATGAAATCAACAAAGTATTAAATATCCAAGATTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS05330 [old locus tag: NWMN_0951 ]
- symbol: NWMN_RS05330
- description: NrdH-redoxin
- length: 77
- theoretical pI: 4.09175
- theoretical MW: 9196.21
- GRAVY: -0.542857
⊟Function[edit | edit source]
- TIGRFAM: glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 45.3)glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 36.7)and 6 moreEnergy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 29.4)Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 23.4)glutaredoxin-family domain (TIGR02190; HMM-score: 19.2)glutaredoxin-like protein (TIGR02200; HMM-score: 18.9)glutaredoxin (TIGR02180; HMM-score: 16.5)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 12.8)
- TheSEED: see NWMN_0951
- PFAM: Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 39.4)and 2 moreGST_N_3; Glutathione S-transferase, N-terminal domain (PF13417; HMM-score: 19.4)Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 17.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9873
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0118
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002124
- TAT(Tat/SPI): 0.000083
- LIPO(Sec/SPII): 0.000549
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]