Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS06350 [old locus tag: NWMN_1124 ]
- pan locus tag?: SAUPAN003497000
- symbol: NWMN_RS06350
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS06350 [old locus tag: NWMN_1124 ]
- symbol: NWMN_RS06350
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1233094..1233372
- length: 279
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_009641 (1233094..1233372) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTGAACTAAAAGTGGGTATAATAAAAAGAGAAGCTAATGTCATTATAAGCAATTCA
ACTGGAGGGAAAGAAATGCAAGTAAACAAAGTTATTTATATTTTATTAGCATTGTTCTTA
GGTAGTTTTGGTATTCATAAATTTTATGCCGGCAAGAATATGCAAGGTATTCTACACTTA
ATATTCTGTTGGACAGGTATCCCACACATTTTAGCAATTATTAGTGCAGTGATTACTGTT
TTCAAACCTGCTGATGAACAAGGTAATGTCACTTTATAA60
120
180
240
279
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS06350 [old locus tag: NWMN_1124 ]
- symbol: NWMN_RS06350
- description: hypothetical protein
- length: 92
- theoretical pI: 9.72064
- theoretical MW: 10145.1
- GRAVY: 0.643478
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined TM2; TM2 domain (PF05154; HMM-score: 62.1)and 1 moreBorrelia_P13; Borrelia membrane protein P13 (PF05628; HMM-score: 13.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003241
- TAT(Tat/SPI): 0.000168
- LIPO(Sec/SPII): 0.004053
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001548522 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFELKVGIIKREANVIISNSTGGKEMQVNKVIYILLALFLGSFGIHKFYAGKNMQGILHLIFCWTGIPHILAIISAVITVFKPADEQGNVTL
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]