From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS07405 [old locus tag: NWMN_1315 ]
  • pan locus tag?: SAUPAN003820000
  • symbol: NWMN_RS07405
  • pan gene symbol?: acyP
  • synonym:
  • product: acylphosphatase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS07405 [old locus tag: NWMN_1315 ]
  • symbol: NWMN_RS07405
  • product: acylphosphatase
  • replicon: chromosome
  • strand: +
  • coordinates: 1446714..1446983
  • length: 270
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1446714..1446983) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1315

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTT
    ACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTAT
    GTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATT
    GAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAAT
    CAAAAATTATCGGATTTTCGATCAATATAA
    60
    120
    180
    240
    270


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS07405 [old locus tag: NWMN_1315 ]
  • symbol: NWMN_RS07405
  • description: acylphosphatase
  • length: 89
  • theoretical pI: 4.71273
  • theoretical MW: 10160.3
  • GRAVY: -0.270787

Function[edit | edit source]

  • reaction:
    EC 3.6.1.7?  ExPASy
    Acylphosphatase An acylphosphate + H2O = a carboxylate + phosphate
  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair carbamoyltransferase HypF (TIGR00143; HMM-score: 50.2)
  • TheSEED: see NWMN_1315
  • PFAM:
    Acylphosphatase (CL0622) Acylphosphatase; Acylphosphatase (PF00708; HMM-score: 77.9)
    and 1 more
    no clan defined TelK_stirrup; Protelomerase, stirrup domain (PF20818; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9964
    • Cytoplasmic Membrane Score: 0.0015
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011045
    • TAT(Tat/SPI): 0.000551
    • LIPO(Sec/SPII): 0.001518
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]