Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1236 [new locus tag: SA_RS07020 ]
- pan locus tag?: SAUPAN003820000
- symbol: SA1236
- pan gene symbol?: acyP
- synonym:
- product: acylphosphatase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1236 [new locus tag: SA_RS07020 ]
- symbol: SA1236
- product: acylphosphatase
- replicon: chromosome
- strand: +
- coordinates: 1409674..1409943
- length: 270
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124075 NCBI
- RefSeq: NP_374517 NCBI
- BioCyc: see SA_RS07020
- MicrobesOnline: 103543 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGACATATACATTTACAAGTATTCGGACGCGTTCAAGGCGTCGGATTTAGATATTTT
ACACAACGCATTGCAATGAACTATAACATTGTCGGTACTGTTCAAAATGTAGATGACTAT
GTAGAGATATATGCACAAGGGGATGACGCAGATATAGAGAGATTTATTCAAGGTGTAATT
GAAGGTGCCTCACCAGCATCAAATGTAACAAGCCATCAACTTGAAGAGTTAGAACTAAAT
CAAAAATTATCGGATTTTCGATCAATATAA60
120
180
240
270
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1236 [new locus tag: SA_RS07020 ]
- symbol: SA1236
- description: acylphosphatase
- length: 89
- theoretical pI: 4.71273
- theoretical MW: 10160.3
- GRAVY: -0.270787
⊟Function[edit | edit source]
- reaction: EC 3.6.1.7? ExPASyAcylphosphatase An acylphosphate + H2O = a carboxylate + phosphate
- TIGRFAM: Protein fate Protein modification and repair carbamoyltransferase HypF (TIGR00143; HMM-score: 50.2)
- TheSEED :
- Acylphosphate phosphohydrolase (EC 3.6.1.7)
- PFAM: Acylphosphatase (CL0622) Acylphosphatase; Acylphosphatase (PF00708; HMM-score: 77.9)and 1 moreno clan defined TelK_stirrup; Protelomerase, stirrup domain (PF20818; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9964
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0
- Extracellular Score: 0.002
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011045
- TAT(Tat/SPI): 0.000551
- LIPO(Sec/SPII): 0.001518
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRHIHLQVFGRVQGVGFRYFTQRIAMNYNIVGTVQNVDDYVEIYAQGDDADIERFIQGVIEGASPASNVTSHQLEELELNQKLSDFRSI
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1236 > SA1237 > SA1238
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]