From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • pan locus tag?: SAUPAN004526000
  • symbol: NWMN_RS09520
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • symbol: NWMN_RS09520
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 1889301..1889444
  • length: 144
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (1889301..1889444) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_1695

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGACAAGAGAAAGAAGATCATTTAGTTCAGAGTTTAAGTTACAAATGGTTAGATTATAT
    AAAAATGGTAAGCCTAGGAATGAAATTATACGCGAGTATGATTTCACACCTTCGACGTTT
    GTAAATGGCGGTTATAAAATGTAG
    60
    120
    144

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS09520 [old locus tag: NWMN_1695 ]
  • symbol: NWMN_RS09520
  • description: transposase
  • length: 47
  • theoretical pI: 10.6298
  • theoretical MW: 5709.53
  • GRAVY: -0.974468

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see NWMN_1695
  • PFAM:
    HTH (CL0123) HTH_Tnp_1; Transposase (PF01527; HMM-score: 24.8)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 21.3)
    and 4 more
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 19.2)
    BrkDBD; Brinker DNA-binding domain (PF09607; HMM-score: 15.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.4)
    no clan defined DUF3734; Patatin phospholipase (PF12536; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7296
    • Cytoplasmic Membrane Score: 0.0802
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.1897
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.079257
    • TAT(Tat/SPI): 0.010139
    • LIPO(Sec/SPII): 0.007873
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTRERRSFSSEFKLQMVRLYKNGKPRNEIIREYDFTPSTFVNGGYKM

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]