From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10350 [old locus tag: NWMN_1805 ]
  • pan locus tag?: SAUPAN001750000
  • symbol: NWMN_RS10350
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10350 [old locus tag: NWMN_1805 ]
  • symbol: NWMN_RS10350
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2012737..2013507
  • length: 771
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2012737..2013507) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCAACATTTAGAACGATAAAAGAAAGTGGCGATTTTGTAACTGTGCATAAATCTTTT
    GTGTTCGATAGTAATTTAAGTGCTAAAGCTAAAGGGATATTATTGTATTTCCTAAGTCGT
    CCTGACAATTGGCAAATATACACGTCAGAAGTAGTTAAACATATGAATGATGGACAAAAA
    TCAATCAATAGTGGCGTTCAAGAACTTATGGATAATAAATATGTTCACAGAATACAAAAA
    AGAGCTGAAAACGGTGTGTTTAAAGGTTTTGAATACTTAGTTTACGAAAAACCAACCGAA
    ATGCCATTTTCGGAAAACGGATTATCGGCAAACGGGTTTTCGGAAAACGGAAAAACGGAA
    AACCGAAAAGGGCGTACTACTAATAATAATAGTACTAATAATGATTTAACTAATAATAAC
    AATACTAATAATGATGGAAGTATATTGTCGGGCAACCCGACTGTGTATTCCATTCCCTAT
    AAAGAAATTATCGAATACTTAAATAAAAAAGCAGGAAAGCATTTTAAACATAATACAGCT
    AAAACAAAAGATTTTATTAAAGCAAGATGGAATCAAGATTTTAGGTTGGAGGATTTTAAA
    AAGGTGATTGATATCAAAACAGCTGAATGGTTAAACACGGATAGCGATAAATACCTTAGA
    CCAGAAACACTTTTTGGCAGTAAATTTGAGGGGTACCTCAATCAAAAAATACAACCAACT
    GGCACGGATCAATTGGAACGCATGAAGTACGACGAAAGTTATTGGGATTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS10350 [old locus tag: NWMN_1805 ]
  • symbol: NWMN_RS10350
  • description: hypothetical protein
  • length: 256
  • theoretical pI: 9.24218
  • theoretical MW: 29656.8
  • GRAVY: -0.933984

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage conserved hypothetical protein, C-terminal domain (TIGR02220; HMM-score: 131.3)
  • TheSEED:
  • PFAM:
    no clan defined Phg_2220_C; Conserved phage C-terminus (Phg_2220_C) (PF09524; HMM-score: 107.6)
    and 1 more
    Telomerase_RBD; Telomerase ribonucleoprotein complex - RNA binding domain (PF12009; HMM-score: 13.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003258
    • TAT(Tat/SPI): 0.000334
    • LIPO(Sec/SPII): 0.000492
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446112368 NCBI
  • RefSeq: WP_000190223 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MATFRTIKESGDFVTVHKSFVFDSNLSAKAKGILLYFLSRPDNWQIYTSEVVKHMNDGQKSINSGVQELMDNKYVHRIQKRAENGVFKGFEYLVYEKPTEMPFSENGLSANGFSENGKTENRKGRTTNNNSTNNDLTNNNNTNNDGSILSGNPTVYSIPYKEIIEYLNKKAGKHFKHNTAKTKDFIKARWNQDFRLEDFKKVIDIKTAEWLNTDSDKYLRPETLFGSKFEGYLNQKIQPTGTDQLERMKYDESYWD

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]