From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS10935 [old locus tag: NWMN_1901 ]
  • pan locus tag?: SAUPAN001379000
  • symbol: NWMN_RS10935
  • pan gene symbol?:
  • synonym:
  • product: HNH endonuclease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS10935 [old locus tag: NWMN_1901 ]
  • symbol: NWMN_RS10935
  • product: HNH endonuclease
  • replicon: chromosome
  • strand: -
  • coordinates: 2114618..2114917
  • length: 300
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2114618..2114917) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATGACTAAAGACGAACGCATACGATTCTATAAGTCTAAAGAATGGCAAACAACAAGA
    AAAAGAGTGCTAGAAAGAGATAATTATGAATGTCAACAATGTAAGAGAGACGGCAAGTTA
    ACGACATATGACAAAAGCAAGCGTAAGTCGTTGGATGTAGATCATATATTATCGCTAGAA
    CATCATCCGGAGTTTGCTCATGACTTAAACAATTTAGAAACACTGTGTATTAAATGTCAC
    AACAAAAAAGAAAAGAGATTTATAAAAAAAGAAAATAAATGGAAAGACGAAAAATGGTAA
    60
    120
    180
    240
    300

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS10935 [old locus tag: NWMN_1901 ]
  • symbol: NWMN_RS10935
  • description: HNH endonuclease
  • length: 99
  • theoretical pI: 9.9015
  • theoretical MW: 12328.1
  • GRAVY: -1.49899

Function[edit | edit source]

  • TIGRFAM:
    decaheme c-type cytochrome, DmsE family (TIGR03508; HMM-score: 15.2)
    and 1 more
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 5.9)
  • TheSEED: data available for USA300_FPR3757
  • PFAM:
    His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 38.8)
    and 5 more
    Multiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 17.4)
    Zn_Beta_Ribbon (CL0167) zf-ISL3; zinc-finger of transposase IS204/IS1001/IS1096/IS1165 (PF14690; HMM-score: 16)
    Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 13.4)
    His-Me_finger (CL0263) HNH_5; HNH endonuclease (PF14279; HMM-score: 12.6)
    Multiheme_cytos (CL0317) Cytochrom_c3_2; Cytochrome c3 (PF14537; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009156
    • TAT(Tat/SPI): 0.00065
    • LIPO(Sec/SPII): 0.004319
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446911080 NCBI
  • RefSeq: WP_000988336 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MMTKDERIRFYKSKEWQTTRKRVLERDNYECQQCKRDGKLTTYDKSKRKSLDVDHILSLEHHPEFAHDLNNLETLCIKCHNKKEKRFIKKENKWKDEKW

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]