From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS11115 [old locus tag: NWMN_1926 ]
  • pan locus tag?: SAUPAN005012000
  • symbol: NWMN_RS11115
  • pan gene symbol?: hlb-2
  • synonym:
  • product: sphingomyelin phosphodiesterase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS11115 [old locus tag: NWMN_1926 ]
  • symbol: NWMN_RS11115
  • product: sphingomyelin phosphodiesterase
  • replicon: chromosome
  • strand: +
  • coordinates: 2132278..2133102
  • length: 825
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2132278..2133102) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGTATCCAAACTGGGGGCAATATAAACGCGCTGATTTAATCGGACAATCTTCTTATATT
    AAAAATAATGATGTCGTAATATTCAATGAAGCATTTGATAATGGTGCATCAGACAAATTA
    TTAAGTAATGTGAAAAAAGAATATCCTTATCAAACACCTGTACTCGGCCGTTCTCAATCA
    GGGTGGGACAAAACTGAAGGTAGCTACTCATCAACTGTTGCAGAAGATGGTGGCGTAGCG
    ATTGTAAGTAAATATCCTATTAAAGAAAAAATCCAGCATGTTTTCAAAAGCGGTTGTGGA
    TTCGATAATGATAGCAACAAAGGCTTTGTTTATACAAAAATAGAGAAAAATGGTAAGAAC
    GTTCACGTTATCGGTACACATACACAATCTGAAGATTCACGTTGTGGTGCTGGACATGAT
    CGAAAAATTAGAGCTGAACAAATGAAAGAAATCAGTGACTTTGTTAAAAAGAAAAATATC
    CCTAAAGATGAAACGGTATATATAGGTGGCGACCTTAATGTCAATAAAGGCACTCCAGAG
    TTCAAAGATATGCTTAAAAACTTGAATGTAAATGATGTTCTATATGCAGGTCATAATAGC
    ACATGGGACCCTCAATCAAATTCAATTGCGAAATATAATTACCCTAATGGTAAACCAGAA
    CATTTAGACTATATATTTACAGATAAAGATCATAAACAACCAAAACAATTAGTCAATGAA
    GTTGTGACTGAAAAACCTAAGCCATGGGATGTATATGCGTTCCCATATTACTACGTTTAC
    AATGATTTTTCAGATCATTACCCAATCAAAGCCTATAGTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    825

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS11115 [old locus tag: NWMN_1926 ]
  • symbol: NWMN_RS11115
  • description: sphingomyelin phosphodiesterase
  • length: 274
  • theoretical pI: 8.15182
  • theoretical MW: 31255.6
  • GRAVY: -0.884672

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 383.3)
  • TheSEED:
  • PFAM:
    DNase_I-like (CL0530) Exo_endo_phos; Endonuclease/Exonuclease/phosphatase family (PF03372; HMM-score: 54)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011623
    • TAT(Tat/SPI): 0.000456
    • LIPO(Sec/SPII): 0.001318
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446205585 NCBI
  • RefSeq: WP_000283440 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]