Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS11815 [old locus tag: NWMN_2046 ]
- pan locus tag?: SAUPAN005439000
- symbol: NWMN_RS11815
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS11815 [old locus tag: NWMN_2046 ]
- symbol: NWMN_RS11815
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2264214..2264444
- length: 231
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181TTGAAGCAATTTCTATATATTGCGTTAGTATGTGGTGTGATAGCAGGTCTTGGTGCTTTC
TTACATATACCGCAGTATCCGAGCATGACAATTCCACGTATAGTAGCTATTTTAGGAATT
ATCAGTGCTATGTTGACTTTTAAAGACAAGCAAATCAGCGCCTCATTAAAGTTTAGCGCA
TTGTTAATTAATGTGCTGCCATTATGCGGTACCTTTGTAGCTTCAAATTAA60
120
180
231
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS11815 [old locus tag: NWMN_2046 ]
- symbol: NWMN_RS11815
- description: hypothetical protein
- length: 76
- theoretical pI: 9.85612
- theoretical MW: 8153.93
- GRAVY: 1.11447
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Chemotaxis and motility flagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 13.9)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: Holin-V (CL0562) Phage_holin_5_2; Phage holin family Hol44, in holin superfamily V (PF16079; HMM-score: 14.4)and 1 moreno clan defined PspC; PspC domain (PF04024; HMM-score: 10.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.112464
- TAT(Tat/SPI): 0.005356
- LIPO(Sec/SPII): 0.103092
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQFLYIALVCGVIAGLGAFLHIPQYPSMTIPRIVAILGIISAMLTFKDKQISASLKFSALLINVLPLCGTFVASN
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]