From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • pan locus tag?: SAUPAN005925000
  • symbol: NWMN_RS13195
  • pan gene symbol?: narI
  • synonym:
  • product: nitrate reductase subunit gamma

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • symbol: NWMN_RS13195
  • product: nitrate reductase subunit gamma
  • replicon: chromosome
  • strand: -
  • coordinates: 2518936..2519613
  • length: 678
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2518936..2519613) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGCTTAATCAGTTTTTATGGGTTATATTTCCGTATTTATGTTTAGTTGTCTTTGTCGCA
    GGTCATATTGCACGTTATCGTTATGATAAATTTTCTTGGACAGCTAAATCTAGTGAATTA
    ATAGAAAGAAAAAGGTTGATGTGGGGAAGTTTATTATTTCACTTAGGTATTATTCCAGTG
    TTTTTTGGACACGTAGTTGGATTGTTAATACCGAAACCATGGATGGATGCAGTGGGTGTG
    TCTGAGCATTTATATCATATAGGCGCTGTTTATATTGGTAGCATCTTTGGTATAATAACT
    TTGATAGGGATGTTTTTATTAACAGCGAGACGTGTTACTACGAAAAGTATTCGAAGATTA
    AGTTCAGCGTCGGATATATTTGTAAATTTCTTATTATTACTTATCGTATTTATGGGATGT
    TACGCAACATTAGTAACAAATATACAACATCCAGACTTTAACTACAGAACTTCATTATCA
    ATTTGGTTTAGACAATTATTTATGTTAAAACCAGATGCGTCATTGATGAGTGGTGTGCCG
    ATTGCATTTAAAATGCATATATTGTTAGGTTTCACTATTATGGCTTGTTGGCCATTTACA
    CGTTTGGTGCATGTTTGGAGTGTACCTTTGACATATATAAATCGCAGATATATTATTTAC
    CGTAAGAATAAAGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    678

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS13195 [old locus tag: NWMN_2294 ]
  • symbol: NWMN_RS13195
  • description: nitrate reductase subunit gamma
  • length: 225
  • theoretical pI: 10.5772
  • theoretical MW: 26145.3
  • GRAVY: 0.651111

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Anaerobic respiratory nitrate reductase, gamma subunit (TIGR00351; EC 1.7.99.4; HMM-score: 238.5)
  • TheSEED:
  • PFAM:
    no clan defined Nitrate_red_gam; Nitrate reductase gamma subunit (PF02665; HMM-score: 293.6)
    and 1 more
    UPF0114; Uncharacterized protein family, UPF0114 (PF03350; HMM-score: 13.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 5
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013116
    • TAT(Tat/SPI): 0.000294
    • LIPO(Sec/SPII): 0.080568
  • predicted transmembrane helices (TMHMM): 5

Accession numbers[edit | edit source]

  • GI: 446856895 NCBI
  • RefSeq: WP_000934151 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MLNQFLWVIFPYLCLVVFVAGHIARYRYDKFSWTAKSSELIERKRLMWGSLLFHLGIIPVFFGHVVGLLIPKPWMDAVGVSEHLYHIGAVYIGSIFGIITLIGMFLLTARRVTTKSIRRLSSASDIFVNFLLLLIVFMGCYATLVTNIQHPDFNYRTSLSIWFRQLFMLKPDASLMSGVPIAFKMHILLGFTIMACWPFTRLVHVWSVPLTYINRRYIIYRKNKV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]