From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS13295 [old locus tag: NWMN_2312 ]
  • pan locus tag?: SAUPAN005947000
  • symbol: NWMN_RS13295
  • pan gene symbol?: tcyB
  • synonym:
  • product: amino acid ABC transporter permease

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS13295 [old locus tag: NWMN_2312 ]
  • symbol: NWMN_RS13295
  • product: amino acid ABC transporter permease
  • replicon: chromosome
  • strand: -
  • coordinates: 2539113..2539832
  • length: 720
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (2539113..2539832) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTTTCTAAATCTAAATAGTGAACAACAACATGCGCTAGATGCTGCAAAACAAGCTTTC
    GGACCTATGCTAGAAGGTTTGGTCAAATATTCAATTCCTATTACATTAGTTACATTTGTT
    TTAGGATTGATTATTGCATTATTTACAGCATTAATGCGAATTTCAACGAGTAAAATTTTA
    AGAAGTATTTCACGTGTCTATGTATCTATTATTCGAGGAACACCAATGATAGTACAACTA
    TTTATCATATTTTATGGTATTCCAGAATTAGGTAGATTATTAACAAATGACGCTGACAAC
    CAATGGACATTGGCACCTGTAGTGGCTGCTATTATTGGTTTATCATTAAATGTAGGTGCG
    TATGCTTCGGAAATTATTCGTGGCGGTATTATTTCTATACCGAAAGGACAAACAGAAGCT
    GCATATTCCATCGGTATGACGTATGGTCAAACGATACAACGTATCATTTTACCGCAGGCA
    ATTCGAGTGTCGATTCCTGCACTAGGTAATACATTTTTAAGTTTAATCAAAGATACATCA
    TTATTAGGATTTATTTTAGTGGCTGAAATGTTTAGAAAAGCTCAAGAAGTTGCGTCTACA
    ACATATGAATATTTAACAATTTATGTGTTAGTTGCGCTAATGTACTGGGTGGTATGCTTT
    ATTATTTCAATTATCCAAGGTATCTATGAATCTTATATTGAAAGAGGGTATCGCTCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS13295 [old locus tag: NWMN_2312 ]
  • symbol: NWMN_RS13295
  • description: amino acid ABC transporter permease
  • length: 239
  • theoretical pI: 9.13859
  • theoretical MW: 26442.2
  • GRAVY: 0.682427

Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, permease protein EhuC (TIGR03004; HMM-score: 159.4)
    ectoine/hydroxyectoine ABC transporter, permease protein EhuD (TIGR03003; HMM-score: 138.3)
    and 7 more
    Metabolism Transport and binding proteins Amino acids, peptides and amines amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family (TIGR01726; HMM-score: 84)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 23.7)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 20.9)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, permease protein PhnE (TIGR01097; HMM-score: 17.5)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthetic protein FliQ (TIGR01402; HMM-score: 15.1)
    Cellular processes Cellular processes Pathogenesis type III secretion protein, HrpO family (TIGR01403; HMM-score: 4.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion protein, HrpO family (TIGR01403; HMM-score: 4.8)
  • TheSEED:
  • PFAM:
    BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 86.7)
    and 5 more
    no clan defined Bac_export_3; Bacterial export proteins, family 3 (PF01313; HMM-score: 15.7)
    DUF3377; Domain of unknown function (DUF3377) (PF11857; HMM-score: 12.6)
    WSS_VP; White spot syndrome virus structural envelope protein VP (PF12175; HMM-score: 11.9)
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 10)
    Oxa1 (CL0376) DUF106; Integral membrane protein DUF106 (PF01956; HMM-score: 9.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004341
    • TAT(Tat/SPI): 0.000217
    • LIPO(Sec/SPII): 0.001597
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit | edit source]

  • GI: 446401721 NCBI
  • RefSeq: WP_000479576 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MFLNLNSEQQHALDAAKQAFGPMLEGLVKYSIPITLVTFVLGLIIALFTALMRISTSKILRSISRVYVSIIRGTPMIVQLFIIFYGIPELGRLLTNDADNQWTLAPVVAAIIGLSLNVGAYASEIIRGGIISIPKGQTEAAYSIGMTYGQTIQRIILPQAIRVSIPALGNTFLSLIKDTSLLGFILVAEMFRKAQEVASTTYEYLTIYVLVALMYWVVCFIISIIQGIYESYIERGYRS

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]