From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0145 [new locus tag: SA_RS00895 ]
  • pan locus tag?: SAUPAN000975000
  • symbol: capB
  • pan gene symbol?: capB
  • synonym: cap8B
  • product: capsular polysaccharide synthesis protein Cap5B

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0145 [new locus tag: SA_RS00895 ]
  • symbol: capB
  • product: capsular polysaccharide synthesis protein Cap5B
  • replicon: chromosome
  • strand: +
  • coordinates: 168093..168779
  • length: 687
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTATATGAAAAACCAAAATCAACA
    ATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCAAATGGTGAA
    GTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACAGTTGTATCG
    AATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGATGGCGATATG
    TGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTATCAAGCTTA
    ATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAAAATTTAGAT
    TTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATTGGGTCTGAAAGGTTC
    AAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGATACACCGCCA
    GTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGTCTGTTAGTA
    ATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTTATGGAAAAA
    GCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAATCTTCTAGT
    TATTATCACTATTATGGAGATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0145 [new locus tag: SA_RS00895 ]
  • symbol: CapB
  • description: capsular polysaccharide synthesis protein Cap5B
  • length: 228
  • theoretical pI: 8.80747
  • theoretical MW: 25231.6
  • GRAVY: -0.390351

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 308)
    and 18 more
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 145.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 120.1)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 119.4)
    cell division ATPase MinD (TIGR01969; HMM-score: 62.9)
    Cellular processes Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 43.1)
    Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 24)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 19.8)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 19.5)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 18.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.7)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.7)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 16.7)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 14.3)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 14.1)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.6)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 13.6)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage replicative helicase, DnaB family (TIGR03600; HMM-score: 13.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.5)
  • TheSEED  :
    • Capsular polysaccharide synthesis enzyme CapB
    • Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    Cell Wall and Capsule Capsular and extracellular polysacchrides Exopolysaccharide Biosynthesis  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    and 2 more
    Cell Wall and Capsule Capsular and extracellular polysacchrides Serotype determining Capsular polysaccharide biosynthesis in Staphylococcus  Capsular polysaccharide synthesis enzyme Cap5B
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Cell envelope-associated LytR-CpsA-Psr transcriptional attenuators  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
  • PFAM:
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 58.9)
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 49.8)
    and 15 more
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 37.4)
    MipZ; ATPase MipZ (PF09140; HMM-score: 33.7)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 24)
    AAA_26; AAA domain (PF13500; HMM-score: 19.9)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 19.7)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19.3)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 17.3)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 16.2)
    nSTAND_NTPase7; Novel STAND NTPase 7 (PF24404; HMM-score: 15.3)
    KTI12; Chromatin associated protein KTI12 (PF08433; HMM-score: 14.8)
    APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13.6)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.5)
    no clan defined UvrA_inter; UvrA interaction domain (PF17760; HMM-score: 13.2)
    P-loop_NTPase (CL0023) NPHP3_N; Nephrocystin 3, N-terminal (PF24883; HMM-score: 12.9)
    AAA_30; AAA domain (PF13604; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7615
    • Cytoplasmic Membrane Score: 0.1901
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.0474
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021296
    • TAT(Tat/SPI): 0.003623
    • LIPO(Sec/SPII): 0.002909
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMCKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CodY (repression) regulon
    CodY(TF)important in Amino acid metabolism; RegPrecise 

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
    Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
    Int J Med Microbiol: 2019, 309(6);151333
    [PubMed:31362856] [WorldCat.org] [DOI] (I p)
  2. S Sau, J Sun, C Y Lee
    Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
    J Bacteriol: 1997, 179(5);1614-21
    [PubMed:9045821] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]