From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00115
  • pan locus tag?: SAUPAN000975000
  • symbol: SAOUHSC_00115
  • pan gene symbol?: capB
  • synonym:
  • product: capsular polysaccharide biosynthesis protein Cap5B

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00115
  • symbol: SAOUHSC_00115
  • product: capsular polysaccharide biosynthesis protein Cap5B
  • replicon: chromosome
  • strand: +
  • coordinates: 120176..120862
  • length: 687
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGTCAAAAAAGGAAAATACGACAACAACACTATTTGTATATGAAAAACCAAAATCAACA
    ATTAGTGAAAAGTTTCGAGGTATACGTTCAAACATCATGTTTTCAAAAGCAAATGGTGAA
    GTAAAGCGCTTATTGGTTACTTCTGAAAAGCCTGGTGCAGGTAAAAGTACAGTTGTATCG
    AATGTAGCGATTACTTATGCACAAGCAGGCTATAAGACATTAGTTATTGATGGCGATATG
    CGTAAGCCAACACAAAACTATATTTTTAATGAGCAAAATAATAATGGACTATCAAGCTTA
    ATCATTGGTCGAACGACTATGTCAGAAGCAATTACGTCGACAGAAATTGAAAATTTAGAT
    TTGCTAACAGCTGGCCCTGTACCTCCAAATCCATCTGAGTTAATTGGGTCTGAAAGGTTC
    AAAGAATTAGTTGATCTGTTTAATAAACGTTACGACATTATTATTGTCGATACACCGCCA
    GTTAATACTGTGACTGATGCACAACTATATGCGCGTGCTATTAAAGATAGTCTGTTAGTA
    ATTGATAGTGAAAAAAATGATAAAAATGAAGTTAAAAAAGCAAAAGCACTTATGGAAAAA
    GCAGGCAGTAACATTCTAGGTGTCATTTTGAACAAGACAAAGGTCGATAAATCTTCTAGT
    TATTATCACTATTATGGAGATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00115
  • symbol: SAOUHSC_00115
  • description: capsular polysaccharide biosynthesis protein Cap5B
  • length: 228
  • theoretical pI: 9.3191
  • theoretical MW: 25284.6
  • GRAVY: -0.421053

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids capsular exopolysaccharide family (TIGR01007; HMM-score: 312.3)
    and 19 more
    chain length determinant protein tyrosine kinase EpsG (TIGR03029; HMM-score: 149.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids exopolysaccharide transport protein family (TIGR01005; HMM-score: 123.9)
    exopolysaccharide/PEP-CTERM locus tyrosine autokinase (TIGR03018; EC 2.7.10.2; HMM-score: 121.2)
    cell division ATPase MinD (TIGR01969; HMM-score: 62)
    Cellular processes Cellular processes Cell division septum site-determining protein MinD (TIGR01968; HMM-score: 42.3)
    Hypothetical proteins Conserved transport-energizing ATPase, TRC40/GET3/ArsA family (TIGR00345; EC 3.6.1.-; HMM-score: 23.7)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides cellulose synthase operon protein YhjQ (TIGR03371; HMM-score: 20.8)
    Metabolism Central intermediary metabolism Nitrogen fixation nitrogenase iron protein (TIGR01287; EC 1.18.6.1; HMM-score: 20.5)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions plasmid partitioning protein RepA (TIGR03453; HMM-score: 20.1)
    helicase/secretion neighborhood CpaE-like protein (TIGR03815; HMM-score: 17)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 16.4)
    signal recognition particle protein SRP54 (TIGR01425; HMM-score: 13.9)
    Metabolism Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 13.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein (TIGR01281; EC 1.3.7.7; HMM-score: 13.4)
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage replicative helicase, DnaB family (TIGR03600; HMM-score: 12.9)
    arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 12.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking signal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.3)
    Metabolism Energy metabolism Photosynthesis chlorophyllide reductase iron protein subunit X (TIGR02016; HMM-score: 12)
  • TheSEED  :
    • Capsular polysaccharide synthesis enzyme CapB
    • Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    Cell Wall and Capsule Capsular and extracellular polysacchrides Exopolysaccharide Biosynthesis  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
    and 1 more
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory Cell envelope-associated LytR-CpsA-Psr transcriptional attenuators  Tyrosine-protein kinase EpsD (EC 2.7.10.2)
  • PFAM:
    P-loop_NTPase (CL0023) AAA_31; AAA domain (PF13614; HMM-score: 59)
    and 14 more
    ParA; NUBPL iron-transfer P-loop NTPase (PF10609; HMM-score: 46.7)
    CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 42.2)
    MipZ; ATPase MipZ (PF09140; HMM-score: 37.9)
    ArsA_ATPase; Anion-transporting ATPase (PF02374; HMM-score: 22)
    AAA_26; AAA domain (PF13500; HMM-score: 20.7)
    Fer4_NifH; 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family (PF00142; HMM-score: 19.7)
    SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 19.5)
    ArgK; ArgK protein (PF03308; HMM-score: 18.8)
    CBP_BcsQ; Cellulose biosynthesis protein BcsQ (PF06564; HMM-score: 18.5)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 16.5)
    Helicase_C; Helicase conserved C-terminal domain (PF00271; HMM-score: 15.4)
    no clan defined AFOR_N; Aldehyde ferredoxin oxidoreductase, N-terminal domain (PF02730; HMM-score: 13.6)
    P-loop_NTPase (CL0023) APS_kinase; Adenylylsulphate kinase (PF01583; HMM-score: 13)
    AAA_30; AAA domain (PF13604; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.01
    • Cytoplasmic Membrane Score: 9.99
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021296
    • TAT(Tat/SPI): 0.003623
    • LIPO(Sec/SPII): 0.002909
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSKKENTTTTLFVYEKPKSTISEKFRGIRSNIMFSKANGEVKRLLVTSEKPGAGKSTVVSNVAITYAQAGYKTLVIDGDMRKPTQNYIFNEQNNNGLSSLIIGRTTMSEAITSTEIENLDLLTAGPVPPNPSELIGSERFKELVDLFNKRYDIIIVDTPPVNTVTDAQLYARAIKDSLLVIDSEKNDKNEVKKAKALMEKAGSNILGVILNKTKVDKSSSYYHYYGDE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: CodY* (repression) regulon, SigB* (activation) regulon
    CodY*(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [6] [3]   other strains

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. ↑ 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  4. ↑ Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
    Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
    Int J Med Microbiol: 2019, 309(6);151333
    [PubMed:31362856] [WorldCat.org] [DOI] (I p)
  5. ↑ S Sau, J Sun, C Y Lee
    Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
    J Bacteriol: 1997, 179(5);1614-21
    [PubMed:9045821] [WorldCat.org] [DOI] (P p)
  6. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_00115&oldid=89362"