Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_00121
- pan locus tag?: SAUPAN000982000
- symbol: SAOUHSC_00121
- pan gene symbol?: capH
- synonym:
- product: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_00121
- symbol: SAOUHSC_00121
- product: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
- replicon: chromosome
- strand: +
- coordinates: 126743..127369
- length: 627
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919830 NCBI
- RefSeq: YP_498721 NCBI
- BioCyc: G1I0R-112 BioCyc
- MicrobesOnline: 1288615 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGGATAGCGATTGAAAAGATAATTGGTTTGCTGAAAAACCAGTCCTCTAAAGAATCG
AATGTTAAGATTCATCGCTTGGCGTATATTACAAACTCAAAATTTGATGGCAATAACTAT
ATAGATAGATGGTGTAAAATCAGGAATTCTCACATTGGTGAATACAGTTATATTGGATTT
GGTAGTGATTTTAATAATGTAGAAGTAGGAAGATATTGTTCGATATCTTCGGATGTAAAA
ATTGGGTTAGGAAAACATCCTACACACTTTTTTAGCTCATCACCGATTTTTTATTCTAAT
AATAATCCATTTAACATAAAGCAAAAGTTTATAGACTTTAATGACCAACCAAGCCGTACA
ACAATTAAAAATGATGTGTGGATTGGTGCAAATGTAATTATTATGGATGGTTTAACAATA
AATACTGGTGCAGTCATAGCAGCCGGCTCAGTTGTTACTAAAAATGTAGGAGCATATGAG
GTTGTTGGTGGTGTTCCTGCAAAAGTGATTAAGAAGCGATTTGACAATAAAACAATTGAA
AAACTTTTGGAAAGCAAGTGGTGGGAGAAAACGCCTGACAAACTAAAAGGATTTTCGGTT
GAATATTTAAATAAAAAGGATACTTAA60
120
180
240
300
360
420
480
540
600
627
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_00121
- symbol: SAOUHSC_00121
- description: capsular polysaccharide biosynthesis protein O-acetyl transferase Cap5H
- length: 208
- theoretical pI: 10.0346
- theoretical MW: 23476.7
- GRAVY: -0.373558
⊟Function[edit | edit source]
- TIGRFAM: phosphonate metabolim protein, transferase hexapeptide repeat family (TIGR03308; HMM-score: 134.3)and 13 more2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase (TIGR03532; EC 2.3.1.89; HMM-score: 62.7)sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family (TIGR03570; HMM-score: 43.7)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)Central intermediary metabolism Amino sugars UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR01173; EC 2.3.1.157,2.7.7.23; HMM-score: 37.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase LpxD (TIGR01853; EC 2.3.1.191; HMM-score: 32.5)glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 31.6)Amino acid biosynthesis Serine family serine O-acetyltransferase (TIGR01172; EC 2.3.1.30; HMM-score: 30.4)colanic acid biosynthesis acetyltransferase WcaF (TIGR04008; EC 2.3.1.-; HMM-score: 29.4)Energy metabolism Other phenylacetic acid degradation protein PaaY (TIGR02287; HMM-score: 22.7)colanic acid biosynthesis acetyltransferase WcaB (TIGR04016; EC 2.3.1.-; HMM-score: 22.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase (TIGR01852; EC 2.3.1.129; HMM-score: 18)UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase (TIGR03992; EC 2.3.1.157,2.7.7.23; HMM-score: 11)
- TheSEED :
- Capsular polysaccharide synthesis enzyme Cap5H
- O-acetyl transferase
- PFAM: HEXAPEP (CL0536) Hexapep; Bacterial transferase hexapeptide (six repeats) (PF00132; HMM-score: 50.1)and 2 moreHexapep_2; Hexapeptide repeat of succinyl-transferase (PF14602; HMM-score: 25)no clan defined DUF411; Protein of unknown function, DUF (PF04214; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.055498
- TAT(Tat/SPI): 0.000935
- LIPO(Sec/SPII): 0.002957
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRIAIEKIIGLLKNQSSKESNVKIHRLAYITNSKFDGNNYIDRWCKIRNSHIGEYSYIGFGSDFNNVEVGRYCSISSDVKIGLGKHPTHFFSSSPIFYSNNNPFNIKQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIKKRFDNKTIEKLLESKWWEKTPDKLKGFSVEYLNKKDT
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [3] : S37 > SAOUHSC_00114 > SAOUHSC_00115 > SAOUHSC_00116 > SAOUHSC_00117 > SAOUHSC_00118 > SAOUHSC_00119 > SAOUHSC_00120 > SAOUHSC_00121 > SAOUHSC_00122 > SAOUHSC_00123 > SAOUHSC_00124 > SAOUHSC_00125 > SAOUHSC_00126 > SAOUHSC_00127predicted SigB promoter [3] : SAOUHSC_00114 > SAOUHSC_00115 > SAOUHSC_00116 > SAOUHSC_00117 > SAOUHSC_00118 > SAOUHSC_00119 > SAOUHSC_00120 > SAOUHSC_00121 > SAOUHSC_00122 > SAOUHSC_00123 > SAOUHSC_00124 > SAOUHSC_00125 > SAOUHSC_00126 > SAOUHSC_00127 > SAOUHSC_00128 > S38 > SAOUHSC_00129
⊟Regulation[edit | edit source]
- regulators: CodY* (repression) regulon, SigB* (activation) regulon
CodY* (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [6] [3] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3] Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 3.2 3.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e) - ↑ Daniela Keinhörster, Shilpa Elizabeth George, Christopher Weidenmaier, Christiane Wolz
Function and regulation of Staphylococcus aureus wall teichoic acids and capsular polysaccharides.
Int J Med Microbiol: 2019, 309(6);151333
[PubMed:31362856] [WorldCat.org] [DOI] (I p) - ↑ S Sau, J Sun, C Y Lee
Molecular characterization and transcriptional analysis of type 8 capsule genes in Staphylococcus aureus.
J Bacteriol: 1997, 179(5);1614-21
[PubMed:9045821] [WorldCat.org] [DOI] (P p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)