Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0160 [new locus tag: SA_RS00970 ]
- pan locus tag?: SAUPAN001001000
- symbol: SA0160
- pan gene symbol?: isdI
- synonym:
- product: heme-degrading monooxygenase IsdI
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0160 [new locus tag: SA_RS00970 ]
- symbol: SA0160
- product: heme-degrading monooxygenase IsdI
- replicon: chromosome
- strand: -
- coordinates: 184042..184368
- length: 327
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1122935 NCBI
- RefSeq: NP_373402 NCBI
- BioCyc: see SA_RS00970
- MicrobesOnline: 102428 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTATGGCAGAAAATAGATTACAATTACAAAAAGGCAGTGCGGAAGAAACGATTGAA
CGTTTTTACAATAGACAAGGCATTGAAACTATTGAAGGCTTCCAACAAATGTTTGTCACT
AAAACATTAAATACCGAGGATACAGACGAAGTTAAAATCTTAACTATTTGGGAATCTGAA
GATAGCTTTAATAATTGGTTGAATTCCGATGTATTTAAAGAAGCTCATAAAAATGTACGT
TTAAAAAGTGATGACGATGGACAGCAAAGTCCAATATTATCAAATAAAGTATTCAAATAT
GATATTGGCTACCACTATCAAAAATAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0160 [new locus tag: SA_RS00970 ]
- symbol: SA0160
- description: heme-degrading monooxygenase IsdI
- length: 108
- theoretical pI: 4.60532
- theoretical MW: 12791.1
- GRAVY: -0.863889
⊟Function[edit | edit source]
- reaction: EC 1.14.99.3? ExPASyTransferred entry: 1.14.14.18EC 1.14.99.48? ExPASyHeme oxygenase (staphylobilin-producing) Protoheme + 5 reduced acceptor + 4 O2 = 5-oxo-delta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O Protoheme + 5 reduced acceptor + 4 O2 = 15-oxo-beta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O
- TIGRFAM:
- TheSEED :
- Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48)
- PFAM: Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 61)and 1 moreDehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9919
- Cytoplasmic Membrane Score: 0.0043
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0034
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002156
- TAT(Tat/SPI): 0.001183
- LIPO(Sec/SPII): 0.000315
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Woo Cheol Lee, Michelle L Reniere, Eric P Skaar, Michael E P Murphy
Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus.
J Biol Chem: 2008, 283(45);30957-63
[PubMed:18713745] [WorldCat.org] [DOI] (P p)Michelle L Reniere, Georgia N Ukpabi, S Reese Harry, Donald F Stec, Robert Krull, David W Wright, Brian O Bachmann, Michael E Murphy, Eric P Skaar
The IsdG-family of haem oxygenases degrades haem to a novel chromophore.
Mol Microbiol: 2010, 75(6);1529-38
[PubMed:20180905] [WorldCat.org] [DOI] (I p)