From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00130
  • pan locus tag?: SAUPAN001001000
  • symbol: SAOUHSC_00130
  • pan gene symbol?: isdI
  • synonym:
  • product: heme-degrading monooxygenase IsdI

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00130
  • symbol: SAOUHSC_00130
  • product: heme-degrading monooxygenase IsdI
  • replicon: chromosome
  • strand: -
  • coordinates: 136125..136451
  • length: 327
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTATGGCAGAAAATAGATTACAATTACAAAAAGGCAGTGCGGAAGAAACGATTGAA
    CGTTTTTACAATAGACAAGGTATTGAAACTATTGAAGGCTTCCAACAAATGTTTGTCACT
    AAAACATTAAATACCGAGGATACAGACGAAGTTAAAATCTTAACTATTTGGGAATCTGAA
    GATAGCTTTAATAATTGGTTGAATTCCGATGTATTTAAAGAAGCTCATAAAAATGTACGT
    TTAAAAAGTGATGACGATGGACAGCAAAGTCCAATATTATCAAATAAAGTATTCAAATAT
    GATATTGGCTACCACTATCAAAAATAA
    60
    120
    180
    240
    300
    327


Protein[edit | edit source]

Protein Data Bank: 2ZDP
Protein Data Bank: 3LGM
Protein Data Bank: 3LGN
Protein Data Bank: 3QGP
Protein Data Bank: 4FNH
Protein Data Bank: 4FNI

General[edit | edit source]

  • locus tag: SAOUHSC_00130
  • symbol: SAOUHSC_00130
  • description: heme-degrading monooxygenase IsdI
  • length: 108
  • theoretical pI: 4.60532
  • theoretical MW: 12791.1
  • GRAVY: -0.863889

Function[edit | edit source]

  • reaction:
    EC 1.14.99.3?  ExPASy
    Transferred entry: 1.14.14.18
    EC 1.14.99.48?  ExPASy
    Heme oxygenase (staphylobilin-producing) Protoheme + 5 reduced acceptor + 4 O2 = 5-oxo-delta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O Protoheme + 5 reduced acceptor + 4 O2 = 15-oxo-beta-bilirubin + Fe2+ + formaldehyde + 5 acceptor + 4 H2O
  • TIGRFAM:
  • TheSEED  :
    • Heme-degrading monooxygenase, staphylobilin-producing (EC 1.14.99.48)
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  Heme-degrading cytoplasmic oxygenase IsdI
  • PFAM:
    Dim_A_B_barrel (CL0032) ABM; Antibiotic biosynthesis monooxygenase (PF03992; HMM-score: 61)
    and 1 more
    Dehydratase_hem; Haem-containing dehydratase (PF13816; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9919
    • Cytoplasmic Membrane Score: 0.0043
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0034
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002156
    • TAT(Tat/SPI): 0.001183
    • LIPO(Sec/SPII): 0.000315
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. 3.0 3.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Eric P Skaar, Andrew H Gaspar, Olaf Schneewind
IsdG and IsdI, heme-degrading enzymes in the cytoplasm of Staphylococcus aureus.
J Biol Chem: 2004, 279(1);436-43
[PubMed:14570922] [WorldCat.org] [DOI] (P p)