Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0188 [new locus tag: SA_RS01120 ]
- pan locus tag?: SAUPAN001037000
- symbol: SA0188
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0188 [new locus tag: SA_RS01120 ]
- symbol: SA0188
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 221933..222214
- length: 282
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1122964 NCBI
- RefSeq: NP_373431 NCBI
- BioCyc: see SA_RS01120
- MicrobesOnline: 102457 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGTGTTAATTACCTATCAAATCATTTTATTTTTTATTATTAGTCTAAGTTACTATTTA
ACTTTAAATCATTACATGGCAGTCACTGTAGGTAACTTCACTTCAATATTCGGCATGTTC
GCAGCCATACTCTTTATGTACTACTACCTACTCTATAAAAGTCCCGAATACAATCAACGC
AAACGATTTAAACATTTCATTCATATCACTAATTTGATAATAATTGCTTTTAGCACCTTC
GTATTAGTTCATTTAGCATTAAAATTATTCTTCAGCATTTAA60
120
180
240
282
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0188 [new locus tag: SA_RS01120 ]
- symbol: SA0188
- description: hypothetical protein
- length: 93
- theoretical pI: 9.91925
- theoretical MW: 11126.4
- GRAVY: 1.01183
⊟Function[edit | edit source]
- TIGRFAM: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 7.1)
- TheSEED :
- N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)
- PFAM: no clan defined DUF3341; Protein of unknown function (DUF3341) (PF11821; HMM-score: 12.1)FAD_DHS (CL0085) PNTB; NAD(P) transhydrogenase beta subunit (PF02233; HMM-score: 12)and 2 moreMarvel-like (CL0396) MARVEL; Membrane-associating domain (PF01284; HMM-score: 9.2)no clan defined DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001778
- TAT(Tat/SPI): 0.000197
- LIPO(Sec/SPII): 0.031669
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILFMYYYLLYKSPEYNQRKRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SA0188 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]