From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01120 [old locus tag: SA0188 ]
  • pan locus tag?: SAUPAN001037000
  • symbol: SA_RS01120
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01120 [old locus tag: SA0188 ]
  • symbol: SA_RS01120
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 221933..222214
  • length: 282
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (221933..222214) NCBI
  • BioCyc: SA_RS01120 BioCyc
  • MicrobesOnline: see SA0188

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGTGTTAATTACCTATCAAATCATTTTATTTTTTATTATTAGTCTAAGTTACTATTTA
    ACTTTAAATCATTACATGGCAGTCACTGTAGGTAACTTCACTTCAATATTCGGCATGTTC
    GCAGCCATACTCTTTATGTACTACTACCTACTCTATAAAAGTCCCGAATACAATCAACGC
    AAACGATTTAAACATTTCATTCATATCACTAATTTGATAATAATTGCTTTTAGCACCTTC
    GTATTAGTTCATTTAGCATTAAAATTATTCTTCAGCATTTAA
    60
    120
    180
    240
    282

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01120 [old locus tag: SA0188 ]
  • symbol: SA_RS01120
  • description: hypothetical protein
  • length: 93
  • theoretical pI: 9.91925
  • theoretical MW: 11126.4
  • GRAVY: 1.01183

Function[edit | edit source]

  • TIGRFAM:
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 7.1)
  • TheSEED: see SA0188
  • PFAM:
    no clan defined MscS_TM; Mechanosensitive ion channel inner membrane domain 1 (PF12794; HMM-score: 11.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.995
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0048
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001778
    • TAT(Tat/SPI): 0.000197
    • LIPO(Sec/SPII): 0.031669
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MVLITYQIILFFIISLSYYLTLNHYMAVTVGNFTSIFGMFAAILFMYYYLLYKSPEYNQRKRFKHFIHITNLIIIAFSTFVLVHLALKLFFSI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]