From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0540 [new locus tag: SA_RS03130 ]
  • pan locus tag?: SAUPAN002361000
  • symbol: SA0540
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA0540 [new locus tag: SA_RS03130 ]
  • symbol: SA0540
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 633528..633896
  • length: 369
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAATTATTTATTATTTTAGGTGCATTAAACGCGATGATGGCTGTCGGAACAGGTGCA
    TTTGGTGCGCATGGTTTACAAGGAAAAATAAGTGATCACTATTTATCAGTATGGGAAAAA
    GCAACGACGTATCAAATGTACCATGGCTTAGCATTATTAATTATAGGTGTAATTAGTGGT
    ACAACTTCAATCAATGTTAACTGGGCTGGCTGGTTAATATTTGCTGGTATTATTTTCTTT
    AGTGGATCATTATATATTTTAGTATTAACTCAAATTAAAGTTTTAGGTGCGATTACGCCA
    ATTGGTGGCGTATTGTTCATCATTGGCTGGATAATGTTAATCATTGCGACATTCAAATTT
    GCTGGTTAA
    60
    120
    180
    240
    300
    360
    369

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA0540 [new locus tag: SA_RS03130 ]
  • symbol: SA0540
  • description: hypothetical protein
  • length: 122
  • theoretical pI: 9.8831
  • theoretical MW: 13064.7
  • GRAVY: 1.15328

Function[edit source | edit]

  • TIGRFAM:
  • TheSEED:  
    UPF0382 membrane protein YwdK
  • PFAM:
    no clan definedDUF423; Protein of unknown function (DUF423) (PF04241; HMM-score: 109.2)
    and 2 more
    DUF3917; Protein of unknown function (DUF3917) (PF13055; HMM-score: 12.7)
    ATP1G1_PLM_MAT8; ATP1G1/PLM/MAT8 family (PF02038; HMM-score: 8.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide SP(Sec/SPI) length 25 aa
    • SP(Sec/SPI): 0.660095
    • TAT(Tat/SPI): 0.008896
    • LIPO(Sec/SPII): 0.069608
    • Cleavage Site: CS pos: 25-26. AHG-LQ. Pr: 0.3590
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISGTTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKFAG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • SA0540 no polycistronic organisation predicted

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]