Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0671 [new locus tag: SA_RS03820 ]
- pan locus tag?: SAUPAN002602000
- symbol: SA0671
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0671 [new locus tag: SA_RS03820 ]
- symbol: SA0671
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 763774..763980
- length: 207
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123478 NCBI
- RefSeq: NP_373926 NCBI
- BioCyc: see SA_RS03820
- MicrobesOnline: 102952 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTATTGTTTATATTGTGCTGTTGTTAATTCTTGTATACGTAAATTATCGATTAGTG
AATCGATTGCTATCTGAAAATAGAATATATGTTGTTCGTTTGATAGTAACAATTACTACT
GTTATAAGCTTTATCCTTGTATACGCATTAATTCACGAACTTATGCCTTTTGTTGTGCGG
GCAATGGATTTAATGTACCACCAGTAA60
120
180
207
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0671 [new locus tag: SA_RS03820 ]
- symbol: SA0671
- description: hypothetical protein
- length: 68
- theoretical pI: 9.46024
- theoretical MW: 8110.97
- GRAVY: 1.34265
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG025881: hypothetical protein in Ammonia conversion cluster
- PFAM: Peptidase_MA (CL0126) Peptidase_M56; BlaR1 peptidase M56 (PF05569; HMM-score: 13.1)and 1 moreno clan defined LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9994
- Cell wall & surface Score: 0
- Extracellular Score: 0.0006
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002358
- TAT(Tat/SPI): 0.000072
- LIPO(Sec/SPII): 0.002292
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MIIVYIVLLLILVYVNYRLVNRLLSENRIYVVRLIVTITTVISFILVYALIHELMPFVVRAMDLMYHQ
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0671 > SA0672 > SA0673
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]