From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03820 [old locus tag: SA0671 ]
  • pan locus tag?: SAUPAN002602000
  • symbol: SA_RS03820
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS03820 [old locus tag: SA0671 ]
  • symbol: SA_RS03820
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 763774..763980
  • length: 207
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (763774..763980) NCBI
  • BioCyc: G1G21-752 BioCyc
  • MicrobesOnline: see SA0671

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATTATTGTTTATATTGTGCTGTTGTTAATTCTTGTATACGTAAATTATCGATTAGTG
    AATCGATTGCTATCTGAAAATAGAATATATGTTGTTCGTTTGATAGTAACAATTACTACT
    GTTATAAGCTTTATCCTTGTATACGCATTAATTCACGAACTTATGCCTTTTGTTGTGCGG
    GCAATGGATTTAATGTACCACCAGTAA
    60
    120
    180
    207

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS03820 [old locus tag: SA0671 ]
  • symbol: SA_RS03820
  • description: hypothetical protein
  • length: 68
  • theoretical pI: 9.46024
  • theoretical MW: 8110.97
  • GRAVY: 1.34265

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA0671
  • PFAM:
    Peptidase_MA (CL0126) Peptidase_M56; BlaR1 peptidase M56 (PF05569; HMM-score: 12.4)
    GPCR_A (CL0192) 7tm_3; 7 transmembrane sweet-taste receptor of 3 GCPR (PF00003; HMM-score: 11)
    and 3 more
    no clan defined 2TM; 2TM domain (PF13239; HMM-score: 9)
    LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 8.4)
    P12; Virus attachment protein p12 family (PF12669; HMM-score: 7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002358
    • TAT(Tat/SPI): 0.000072
    • LIPO(Sec/SPII): 0.002292
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIIVYIVLLLILVYVNYRLVNRLLSENRIYVVRLIVTITTVISFILVYALIHELMPFVVRAMDLMYHQ

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]