From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • pan locus tag?: SAUPAN003179000
  • symbol: SA0866
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • symbol: SA0866
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 979642..980496
  • length: 855
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAATTTAAGTATCATATATCACAACAAGAAACTGTTAAAGCTTTTTTAGCACGACAT
    GATTTTTCTAAGAAGACAGTGAGCGCCATTAAAAATAATGGCGCTTTAATTGTTAATGAT
    GAACCAGTCACAGTACGTAAGCAATTAATGCCAAATGATATATTAGAAATTCATTTACCG
    CGAGAAATACCGAGTGTTAATTTAATACCTTATGCTCGTAAGCTAGAAGTATTGTATGAA
    GATGCTTTTATCATCATAGTTACTAAACCAAACAATCAAAATTGTACGCCTTCGAGAGAA
    CATCCTCATGAAAGTTTAATCGAACAAGTACTATATCATTGTCAGGAACATGGTGAAAAT
    ATTAACCCACATATTGTTACGCGTCTAGATCGTAATACAACTGGTATTGTGATATTCGCT
    AAATATGGACATATCCATCATTTATTTTCTAAAGTAAACTTGAAAAAAATATATACTTGC
    CTTGTATATGGCAAAACCCATACATCTGGTATTATTGAAGCTAATATTAGACGGTCAAAG
    GATAGTATTATAACTAGAGAAGTTGCCTCGGATGGTAAATACGCTAAAACATCTTATGAA
    GTAATAAATCAGAATGATAAATACAGTTTATGCAAAGTTCATTTGCATACGGGACGTACA
    CATCAAATTCGTGTACATTTTCAACATATTGGGCATCCAATTGTGGGAGATTCTTTGTAT
    GATGGTTTTCATGACAAAATTCATGGTCAAGTACTGCAATGTACGCAAATATATTTTGTT
    CATCCAATCAATAAGAACAATATTTATATTACAATTGATTATAAGCAATTACTTAAATTA
    TTCAATCAACTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    855

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0866 [new locus tag: SA_RS04900 ]
  • symbol: SA0866
  • description: hypothetical protein
  • length: 284
  • theoretical pI: 9.46148
  • theoretical MW: 32899.6
  • GRAVY: -0.377465

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification pseudouridine synthase, RluA family (TIGR00005; EC 5.4.99.-; HMM-score: 182.2)
    and 2 more
    Genetic information processing Protein synthesis tRNA and rRNA base modification pseudouridine synthase Rlu family protein, TIGR01621 (TIGR01621; EC 5.4.99.-; HMM-score: 76)
    Genetic information processing Protein synthesis tRNA and rRNA base modification pseudouridine synthase (TIGR00093; EC 5.4.99.-; HMM-score: 31.8)
  • TheSEED:  
    Clustering-based subsystems Nucleotidyl-phosphate metabolic cluster CBSS-222523.1.peg.1311  Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
    and 1 more
    Protein Metabolism Protein biosynthesis Ribosome biogenesis bacterial  Similar to ribosomal large subunit pseudouridine synthase D, Bacillus subtilis YjbO type
  • PFAM:
    PseudoU_synth (CL0649) PseudoU_synth_2; RNA pseudouridylate synthase (PF00849; HMM-score: 88.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003367
    • TAT(Tat/SPI): 0.000324
    • LIPO(Sec/SPII): 0.00065
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKFKYHISQQETVKAFLARHDFSKKTVSAIKNNGALIVNDEPVTVRKQLMPNDILEIHLPREIPSVNLIPYARKLEVLYEDAFIIIVTKPNNQNCTPSREHPHESLIEQVLYHCQEHGENINPHIVTRLDRNTTGIVIFAKYGHIHHLFSKVNLKKIYTCLVYGKTHTSGIIEANIRRSKDSIITREVASDGKYAKTSYEVINQNDKYSLCKVHLHTGRTHQIRVHFQHIGHPIVGDSLYDGFHDKIHGQVLQCTQIYFVHPINKNNIYITIDYKQLLKLFNQL

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]