Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1004 [new locus tag: SA_RS05695 ]
- pan locus tag?: SAUPAN003405000
- symbol: SA1004
- pan gene symbol?: scc
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1004 [new locus tag: SA_RS05695 ]
- symbol: SA1004
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1136409..1136759
- length: 351
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123832 NCBI
- RefSeq: NP_374275 NCBI
- BioCyc: see SA_RS05695
- MicrobesOnline: 103301 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAATTTAAAAAATATATATTAACAGGAACATTAGCATTACTTTTATCATCAACTGGG
ATAGCAACTATAGAAGGGAATAAAGCAGATGCAAGTAGTCTGGACAAATATTTAACTGAA
AGTCAGTTTCATGATAAACGCATAGCAGAAGAATTAAGAACTTTACTTAACAAATCGAAT
GTATATGCATTAGCTGCAGGAAGCTTAAATCCATATTATAAACGTACGATTATGATGAAT
GAATATAGAGCTAAAGCGGCACTTAAGAAAAATGATTTCGTATCAATGGCTGATGCTAAA
GTTGCATTAGAAAAAATATACAAAGAAATTGATGAAATTATAAATAGATAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1004 [new locus tag: SA_RS05695 ]
- symbol: SA1004
- description: hypothetical protein
- length: 116
- theoretical pI: 9.86614
- theoretical MW: 13114.1
- GRAVY: -0.287931
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: 7
- Predicted Cleavage Site: No CleavageSite
- SignalP: Signal peptide SP(Sec/SPI) length 31 aa
- SP(Sec/SPI): 0.922255
- TAT(Tat/SPI): 0.00225
- LIPO(Sec/SPII): 0.046518
- Cleavage Site: CS pos: 31-32. ADA-SS. Pr: 0.6778
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFKKYILTGTLALLLSSTGIATIEGNKADASSLDKYLTESQFHDKRIAEELRTLLNKSNVYALAAGSLNPYYKRTIMMNEYRAKAALKKNDFVSMADAKVALEKIYKEIDEIINR
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- data available for NCTC8325
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]
Ilse Jongerius, Jörg Köhl, Manoj K Pandey, Maartje Ruyken, Kok P M van Kessel, Jos A G van Strijp, Suzan H M Rooijakkers
Staphylococcal complement evasion by various convertase-blocking molecules.
J Exp Med: 2007, 204(10);2461-71
[PubMed:17893203] [WorldCat.org] [DOI] (P p)