From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1015 [new locus tag: SA_RS05775 ]
  • pan locus tag?: SAUPAN003434000
  • symbol: SA1015
  • pan gene symbol?:
  • synonym: elxI1
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1015 [new locus tag: SA_RS05775 ]
  • symbol: SA1015
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1149809..1150036
  • length: 228
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACACATTTGACAAAGGTTTTAGATACACTAACTGGAATATGCGTAGTATTATTATTT
    AGTAAATATTTTGTGGCGTATGCAAATATGGTGTTTGATTGGAATTTAAGATGGTATTTG
    CTAGAAAACATACCACATTTGCCAATTATATTATTTATTCTGATGTTTATTTTCGGAGTA
    CCTTCTGAAATGATAAAAGATAGGCAAAGGAAAAATAACGGTGTTTAA
    60
    120
    180
    228

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1015 [new locus tag: SA_RS05775 ]
  • symbol: SA1015
  • description: hypothetical protein
  • length: 75
  • theoretical pI: 9.15991
  • theoretical MW: 8862.61
  • GRAVY: 0.574667

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108137: hypothetical protein
  • PFAM:
    no clan defined DUF1056; Protein of unknown function (DUF1056) (PF06341; HMM-score: 13.1)
    PsbI; Photosystem II reaction centre I protein (PSII 4.8 kDa protein) (PF02532; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9928
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0071
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012131
    • TAT(Tat/SPI): 0.001632
    • LIPO(Sec/SPII): 0.003928
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTHLTKVLDTLTGICVVLLFSKYFVAYANMVFDWNLRWYLLENIPHLPIILFILMFIFGVPSEMIKDRQRKNNGV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]