Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1079 [new locus tag: SA_RS06115 ]
- pan locus tag?: SAUPAN003523000
- symbol: SA1079
- pan gene symbol?: —
- synonym:
- product: DNA-binding protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1079 [new locus tag: SA_RS06115 ]
- symbol: SA1079
- product: DNA-binding protein
- replicon: chromosome
- strand: +
- coordinates: 1221948..1222280
- length: 333
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123910 NCBI
- RefSeq: NP_374352 NCBI
- BioCyc: see SA_RS06115
- MicrobesOnline: 103378 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGGGCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTCGAAGATTATTCT
TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
CGTTATATTCAACAATTAGAAGACTTAGAATAG60
120
180
240
300
333
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1079 [new locus tag: SA_RS06115 ]
- symbol: SA1079
- description: DNA-binding protein
- length: 110
- theoretical pI: 4.42952
- theoretical MW: 13581.1
- GRAVY: -0.924545
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)and 12 moretranscriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
- TheSEED :
- Signal recognition particle associated protein
- PFAM: HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)and 17 moreSigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.5)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 29.5)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 23.4)HTH_11; HTH domain (PF08279; HMM-score: 22.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.7)Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.3)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 17.6)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 16.1)HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 15.7)no clan defined DUF7769; Domain of unknown function (DUF7769) (PF24964; HMM-score: 15)HTH (CL0123) TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.3)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 13.7)DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.1)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.3)P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9887
- Cytoplasmic Membrane Score: 0.0075
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0037
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000792
- TAT(Tat/SPI): 0.000155
- LIPO(Sec/SPII): 0.00019
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: smc > SA1078 > SA1079 > ffh
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]