PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA_RS06115 [old locus tag: SA1079 ]
• pan locus tag^?: SAUPAN003523000
• symbol: SA_RS06115
• pan gene symbol^?: —
• synonym:
• product: DNA-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA_RS06115 [old locus tag: SA1079 ]
• symbol: SA_RS06115
• product: DNA-binding protein
• replicon: chromosome
• strand: +
• coordinates: 1221948..1222280
• length: 333
• essential: no DEG other strains

⊟Accession numbers

• Location: NC_002745 (1221948..1222280) NCBI
• BioCyc: SA_RS06115 BioCyc
• MicrobesOnline: see SA1079

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  
  ATGGGGCAAAATGATTTAGTTAAAACGTTACGAATGAATTATTTGTTTGATTTTTATCAA
  TCCTTATTGACGAATAAACAACGTAATTATTTGGAATTATTTTATCTCGAAGATTATTCT
  TTAAGTGAAATCGCAGATACTTTTAATGTGAGTAGACAAGCAGTTTATGATAATATAAGA
  AGAACTGGCGATTTAGTTGAAGATTATGAAAAGAAATTGGAATTATACCAGAAATTTGAG
  CAACGCCGAGAAATATATGATGAAATGAAACAACATTTAAGTAATCCAGAACAAATACAA
  CGTTATATTCAACAATTAGAAGACTTAGAATAG
  60
  120
  180
  240
  300
  333
  

⊟Protein

⊟General

• locus tag: SA_RS06115 [old locus tag: SA1079 ]
• symbol: SA_RS06115
• description: DNA-binding protein
• length: 110
• theoretical pI: 4.42952
• theoretical MW: 13581.1
• GRAVY: -0.924545

⊟Function

• TIGRFAM:
  RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 27.6)
  and 12 more
  transcriptional regulator BotR, P-21 (TIGR03209; HMM-score: 20.3)
  RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 18.4)
  RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 17.9)
  RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 17.9)
  RNA polymerase sigma-W factor (TIGR02948; HMM-score: 17.6)
  RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 17.4)
  RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 17.1)
  RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 16.7)
  RNA polymerase sigma factor, SigM family (TIGR02950; HMM-score: 15.2)
  RNA polymerase sigma factor, TIGR02999 family (TIGR02999; HMM-score: 14.3)
  Metabolism Energy metabolism Fermentation methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
  Metabolism Energy metabolism Amino acids and amines methylaspartate ammonia-lyase (TIGR01502; EC 4.3.1.2; HMM-score: 13.1)
• TheSEED: see SA1079
• PFAM:
  HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 142.6)
  and 22 more
  Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 29.9)
  Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 28.6)
  HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 24)
  HTH_11; HTH domain (PF08279; HMM-score: 21.8)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 21.7)
  Sigma70_ECF; ECF sigma factor (PF07638; HMM-score: 18.4)
  HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 17.8)
  HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 17.4)
  HTH_10; HTH DNA binding domain (PF04967; HMM-score: 15.9)
  HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.2)
  HTH_40; Helix-turn-helix domain (PF14493; HMM-score: 15)
  HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 14.2)
  TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 14.1)
  Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 13.9)
  no clan defined Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.7)
  HTH (CL0123) HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.5)
  DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 13.1)
  GerE; Bacterial regulatory proteins, luxR family (PF00196; HMM-score: 12.7)
  GcrA; GcrA cell cycle regulator (PF07750; HMM-score: 12.6)
  HTH_22; HTH domain (PF13309; HMM-score: 12.6)
  TetR_N; Bacterial regulatory proteins, tetR family (PF00440; HMM-score: 11.8)
  P-loop_NTPase (CL0023) AAA_23; AAA domain (PF13476; HMM-score: 11.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.000792
  • TAT(Tat/SPI): 0.000155
  • LIPO(Sec/SPII): 0.00019
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446453465 NCBI
• RefSeq: WP_000531320 NCBI
• UniProt: see SA1079

⊟Protein sequence

• MGQNDLVKTLRMNYLFDFYQSLLTNKQRNYLELFYLEDYSLSEIADTFNVSRQAVYDNIRRTGDLVEDYEKKLELYQKFEQRREIYDEMKQHLSNPEQIQRYIQQLEDLE

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications