From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • pan locus tag?: SAUPAN004607000
  • symbol: SA1640
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • symbol: SA1640
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1874153..1874647
  • length: 495
  • essential: no DEG

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAGGAGATTACTCAGTCTATTACTAGCTAGTACAATGATTTTAGTCGCATGTGGGAAT
    GCTAACAATGAAAATAAGAAAAAGGAAGACGAAAAAAAATCAGAAGTAAAAAAAGAAGCT
    ACGAAAAATAATGATAAACCAAAGAACGAAAAGAAGAATCAAGATATAAATAAAAACAAT
    AATGAGCAAGTTCAAAATGTCAATAATAAACAACCAGTCTTAAATAATAATAGTAATCAT
    AACAATCAACAACAAAGCAATAAAAATAATTACACAGTTATAGAAAACGGGAATACAGTT
    ACAGAAATTTATAATGGACAATCACACACAACTACAAATAACCCTATTAGAGAAGAATAT
    GTAGAGGGAGAAACAGACCCGATATATAAAAGAGAGTATAAGCATTTTTATACACCTGAA
    GAAGCTCAAAGAGCACAAGAAAATAGCGACCAAATTTTAAGAGAAATGGGTCTCGAACCA
    GAAAGATATGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    495


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1640 [new locus tag: SA_RS09225 ]
  • symbol: SA1640
  • description: hypothetical protein
  • length: 164
  • theoretical pI: 6.29008
  • theoretical MW: 19125.8
  • GRAVY: -1.54939

Function[edit | edit source]

  • TIGRFAM:
    mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 16.9)
    Cellular processes Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.5)
    and 6 more
    Sec region non-globular protein (TIGR04420; HMM-score: 9.1)
    cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 8.1)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7.6)
    GLPGLI family protein (TIGR01200; HMM-score: 6.2)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 4.1)
    Cellular processes Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 3.3)
  • TheSEED  :
    • FIG01108503: hypothetical protein
  • PFAM:
    no clan defined DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 15.6)
    FAM176; FAM176 family (PF14851; HMM-score: 12.7)
    and 14 more
    AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 11.3)
    no clan defined Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 10.2)
    Thioredoxin (CL0172) SelP_N; Selenoprotein P, N terminal region (PF04592; HMM-score: 10)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 9.4)
    no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 9.4)
    GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 8.3)
    FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 8.2)
    DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 8)
    no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7.7)
    GRP; Glycine rich protein family (PF07172; HMM-score: 7.6)
    Serinc; Serine incorporator (Serinc) (PF03348; HMM-score: 7.4)
    GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 7.2)
    no clan defined DUF6556; Family of unknown function (DUF6556) (PF20193; HMM-score: 7)
    NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 6.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0046
    • Cytoplasmic Membrane Score: 0.5165
    • Cell wall & surface Score: 0.1366
    • Extracellular Score: 0.3423
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: -0.33
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: ILVACGN
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000858
    • TAT(Tat/SPI): 0.000097
    • LIPO(Sec/SPII): 0.998715
    • Cleavage Site: CS pos: 17-18. LVA-CG. Pr: 0.9992
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRRLLSLLLASTMILVACGNANNENKKKEDEKKSEVKKEATKNNDKPKNEKKNQDINKNNNEQVQNVNNKQPVLNNNSNHNNQQQSNKNNYTVIENGNTVTEIYNGQSHTTTNNPIREEYVEGETDPIYKREYKHFYTPEEAQRAQENSDQILREMGLEPERYE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]