Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1640 [new locus tag: SA_RS09225 ]
- pan locus tag?: SAUPAN004607000
- symbol: SA1640
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1640 [new locus tag: SA_RS09225 ]
- symbol: SA1640
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1874153..1874647
- length: 495
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124483 NCBI
- RefSeq: NP_374929 NCBI
- BioCyc: see SA_RS09225
- MicrobesOnline: 103955 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAGGAGATTACTCAGTCTATTACTAGCTAGTACAATGATTTTAGTCGCATGTGGGAAT
GCTAACAATGAAAATAAGAAAAAGGAAGACGAAAAAAAATCAGAAGTAAAAAAAGAAGCT
ACGAAAAATAATGATAAACCAAAGAACGAAAAGAAGAATCAAGATATAAATAAAAACAAT
AATGAGCAAGTTCAAAATGTCAATAATAAACAACCAGTCTTAAATAATAATAGTAATCAT
AACAATCAACAACAAAGCAATAAAAATAATTACACAGTTATAGAAAACGGGAATACAGTT
ACAGAAATTTATAATGGACAATCACACACAACTACAAATAACCCTATTAGAGAAGAATAT
GTAGAGGGAGAAACAGACCCGATATATAAAAGAGAGTATAAGCATTTTTATACACCTGAA
GAAGCTCAAAGAGCACAAGAAAATAGCGACCAAATTTTAAGAGAAATGGGTCTCGAACCA
GAAAGATATGAATAA60
120
180
240
300
360
420
480
495
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1640 [new locus tag: SA_RS09225 ]
- symbol: SA1640
- description: hypothetical protein
- length: 164
- theoretical pI: 6.29008
- theoretical MW: 19125.8
- GRAVY: -1.54939
⊟Function[edit | edit source]
- TIGRFAM: mycoides cluster lipoprotein, LppA/P72 family (TIGR03490; HMM-score: 16.9)Cellular processes Sporulation and germination sporulation lipoprotein, YhcN/YlaJ family (TIGR02898; HMM-score: 15.5)and 6 moreSec region non-globular protein (TIGR04420; HMM-score: 9.1)cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 8.1)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 7.6)GLPGLI family protein (TIGR01200; HMM-score: 6.2)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 4.1)Cellular processes Sporulation and germination stage III sporulation protein AE (TIGR02829; HMM-score: 3.3)
- TheSEED :
- FIG01108503: hypothetical protein
- PFAM: no clan defined DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 15.6)FAM176; FAM176 family (PF14851; HMM-score: 12.7)and 14 moreAhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 11.3)no clan defined Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 10.2)Thioredoxin (CL0172) SelP_N; Selenoprotein P, N terminal region (PF04592; HMM-score: 10)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 9.4)no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 9.4)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 8.3)FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 8.2)DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 8)no clan defined PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 7.7)GRP; Glycine rich protein family (PF07172; HMM-score: 7.6)Serinc; Serine incorporator (Serinc) (PF03348; HMM-score: 7.4)GT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 7.2)no clan defined DUF6556; Family of unknown function (DUF6556) (PF20193; HMM-score: 7)NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 6.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0046
- Cytoplasmic Membrane Score: 0.5165
- Cell wall & surface Score: 0.1366
- Extracellular Score: 0.3423
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: ILVACGN
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000858
- TAT(Tat/SPI): 0.000097
- LIPO(Sec/SPII): 0.998715
- Cleavage Site: CS pos: 17-18. LVA-CG. Pr: 0.9992
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRRLLSLLLASTMILVACGNANNENKKKEDEKKSEVKKEATKNNDKPKNEKKNQDINKNNNEQVQNVNNKQPVLNNNSNHNNQQQSNKNNYTVIENGNTVTEIYNGQSHTTTNNPIREEYVEGETDPIYKREYKHFYTPEEAQRAQENSDQILREMGLEPERYE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]