From AureoWiki
Jump to navigation Jump to search
COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1775 [new locus tag: SA_RS10205 ]
  • pan locus tag?:
  • symbol: SA1775
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1775 [new locus tag: SA_RS10205 ]
  • symbol: SA1775
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2027744..2028481
  • length: 738
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAAGCGGAGATTAAAGGCGTCATCGTTTCCAACGAAGATAAATGGGTTTACGAAATG
    CTTGGTATGGATTCGACTTGTCCTAAAGATGTTTTAACACAACTAGAATTTAGTGATGAA
    GATGTTGATATTATAATTAACTCAAATGGTGGTAACCTAGTAGCTGGTAGTGAAATATAT
    ACACATTTAAGAGCTCATAAAGGCAAAGTGAATGTTCGTATCACAGCAATAGCAGCAAGT
    GCGGCATCGCTTATCGCAATGGCTGGTGACCACATCGAAATGAGTCCGGTTGCTAGAATG
    ATGATTCACAATCCTTCAAGTATTGCGCAAGGAGAAGCGAAAGATCTAAATCATGCTGCA
    GAAACATTAGAACATGTTGGTCAAATAATGGCTGAGGCATATGCGGTTAGAGCTGGTAAA
    AACAAACAAGAACTTGTAGAAATGATGGCTAGGGAAACGTGGCTAAATGCTGATGAAGCC
    ATTGAACAAGGTTTTGCGGATAGTAAAATGTTTGAAAACGACAATATGCAAATTGTAGCA
    AGCAATACACAAGTGTTATCGAAAGATGTATTAAATCGTGTAACAGCTTTGGTAAGTAAA
    ACGCCAGAGGTTAACATTGATATTGACGCAATAGCAAATAAAGTAATTGAAAAAATAAAT
    ATGAAAGAAAAGGAATCAGAAATCGATGTTGCAGATAGTAAAGTATCAGCAAATGGATTT
    TCAAGATTCCTTTTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    738

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1775 [new locus tag: SA_RS10205 ]
  • symbol: SA1775
  • description: hypothetical protein
  • length: 245
  • theoretical pI: 4.59748
  • theoretical MW: 26839.4
  • GRAVY: -0.161224

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp endopeptidase, proteolytic subunit ClpP (TIGR00493; EC 3.4.21.92; HMM-score: 63.1)
    and 1 more
    Genetic information processing Protein fate Degradation of proteins, peptides, and glycopeptides signal peptide peptidase SppA, 36K type (TIGR00706; EC 3.4.-.-; HMM-score: 25.8)
  • TheSEED:  
    Regulation and Cell signaling Regulation and Cell signaling - no subcategory cAMP signaling in bacteria  Prophage Clp protease-like protein
  • PFAM:
    ClpP_crotonase (CL0127) CLP_protease; Clp protease (PF00574; HMM-score: 110)
    and 5 more
    SDH_sah; Serine dehydrogenase proteinase (PF01972; HMM-score: 33.6)
    Peptidase_S49; Peptidase family S49 (PF01343; HMM-score: 15.1)
    no clan defined S-AdoMet_synt_N; S-adenosylmethionine synthetase, N-terminal domain (PF00438; HMM-score: 14.1)
    DUF3570; Protein of unknown function (DUF3570) (PF12094; HMM-score: 12.4)
    PLN_propep; Protealysin propeptide (PF16485; HMM-score: 12.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008625
    • TAT(Tat/SPI): 0.000174
    • LIPO(Sec/SPII): 0.001238
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKAEIKGVIVSNEDKWVYEMLGMDSTCPKDVLTQLEFSDEDVDIIINSNGGNLVAGSEIYTHLRAHKGKVNVRITAIAASAASLIAMAGDHIEMSPVARMMIHNPSSIAQGEAKDLNHAAETLEHVGQIMAEAYAVRAGKNKQELVEMMARETWLNADEAIEQGFADSKMFENDNMQIVASNTQVLSKDVLNRVTALVSKTPEVNIDIDAIANKVIEKINMKEKESEIDVADSKVSANGFSRFLF

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]