Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1825 [new locus tag: SA_RS10475 ]
- pan locus tag?: SAUPAN005223000
- symbol: SA1825
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1825 [new locus tag: SA_RS10475 ]
- symbol: SA1825
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2064249..2064590
- length: 342
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124717 NCBI
- RefSeq: NP_375126 NCBI
- BioCyc: see SA_RS10475
- MicrobesOnline: 104152 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGCAAAGTATCGCAGAAAAAGAGACGTATCATTTACCCACCGAACACCTGCAAGTTTTC
AATGTGATAAAAAATACGTCCAATAAGTATATTACTAAAACTAAAATCTTAAATCAATTG
GGATATGAATATAATTCAAGCAATGAACGATGGTTACGAAGAGTAATCAATTCATTAGTA
TATGATTATGGCTATCCTATCGGATGCAGTTATAAACCTAGTGAACGTGGTTATTACATC
ATTACGACAGAACAAGAAAAGCAACAAGCGATGAGAAGTATTAAGAAATTAGCTGATGGC
AGTATGAAACGCTATGAAGCTTTGAAACGAATTAAAGTGTAA60
120
180
240
300
342
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1825 [new locus tag: SA_RS10475 ]
- symbol: SA1825
- description: hypothetical protein
- length: 113
- theoretical pI: 9.95139
- theoretical MW: 13393.3
- GRAVY: -0.780531
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical SAV0795 homolog in superantigen-encoding pathogenicity islands SaPI
- PFAM: HTH (CL0123) DUF7646; Domain of unknown function (DUF7646) (PF24657; HMM-score: 17.1)no clan defined DUF7599; Domain of unknown function (DUF7599) (PF24538; HMM-score: 15.2)HTH (CL0123) DUF977; Bacterial protein of unknown function (DUF977) (PF06163; HMM-score: 14.8)no clan defined LPD13; Large polyvalent protein-associated domain 13 (PF18825; HMM-score: 14.2)and 2 moreADP-ribosyl (CL0084) DUF3990; Protein of unknown function (DUF3990) (PF13151; HMM-score: 13.4)no clan defined DUF1823; Domain of unknown function (DUF1823) (PF08853; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8287
- Cytoplasmic Membrane Score: 0.0134
- Cell wall & surface Score: 0.0042
- Extracellular Score: 0.1537
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.116196
- TAT(Tat/SPI): 0.000533
- LIPO(Sec/SPII): 0.003365
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MQSIAEKETYHLPTEHLQVFNVIKNTSNKYITKTKILNQLGYEYNSSNERWLRRVINSLVYDYGYPIGCSYKPSERGYYIITTEQEKQQAMRSIKKLADGSMKRYEALKRIKV
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]