From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10475 [old locus tag: SA1825 ]
  • pan locus tag?: SAUPAN005223000
  • symbol: SA_RS10475
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10475 [old locus tag: SA1825 ]
  • symbol: SA_RS10475
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2064249..2064590
  • length: 342
  • essential: no DEG

Accession numbers[edit | edit source]

  • Location: NC_002745 (2064249..2064590) NCBI
  • BioCyc: SA_RS10475 BioCyc
  • MicrobesOnline: see SA1825

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAAGTATCGCAGAAAAAGAGACGTATCATTTACCCACCGAACACCTGCAAGTTTTC
    AATGTGATAAAAAATACGTCCAATAAGTATATTACTAAAACTAAAATCTTAAATCAATTG
    GGATATGAATATAATTCAAGCAATGAACGATGGTTACGAAGAGTAATCAATTCATTAGTA
    TATGATTATGGCTATCCTATCGGATGCAGTTATAAACCTAGTGAACGTGGTTATTACATC
    ATTACGACAGAACAAGAAAAGCAACAAGCGATGAGAAGTATTAAGAAATTAGCTGATGGC
    AGTATGAAACGCTATGAAGCTTTGAAACGAATTAAAGTGTAA
    60
    120
    180
    240
    300
    342

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS10475 [old locus tag: SA1825 ]
  • symbol: SA_RS10475
  • description: hypothetical protein
  • length: 113
  • theoretical pI: 9.95139
  • theoretical MW: 13393.3
  • GRAVY: -0.780531

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1825
  • PFAM:
    HTH (CL0123) DUF7646; Domain of unknown function (DUF7646) (PF24657; HMM-score: 17.1)
    no clan defined DUF7599; Domain of unknown function (DUF7599) (PF24538; HMM-score: 15.2)
    HTH (CL0123) DUF977; Bacterial protein of unknown function (DUF977) (PF06163; HMM-score: 14.8)
    no clan defined LPD13; Large polyvalent protein-associated domain 13 (PF18825; HMM-score: 14.2)
    and 2 more
    ADP-ribosyl (CL0084) DUF3990; Protein of unknown function (DUF3990) (PF13151; HMM-score: 13.4)
    no clan defined DUF1823; Domain of unknown function (DUF1823) (PF08853; HMM-score: 13)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8287
    • Cytoplasmic Membrane Score: 0.0134
    • Cell wall & surface Score: 0.0042
    • Extracellular Score: 0.1537
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.116196
    • TAT(Tat/SPI): 0.000533
    • LIPO(Sec/SPII): 0.003365
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MQSIAEKETYHLPTEHLQVFNVIKNTSNKYITKTKILNQLGYEYNSSNERWLRRVINSLVYDYGYPIGCSYKPSERGYYIITTEQEKQQAMRSIKKLADGSMKRYEALKRIKV

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]