Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1831 [new locus tag: SA_RS10505 ]
- pan locus tag?: SAUPAN005250000
- symbol: SA1831
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1831 [new locus tag: SA_RS10505 ]
- symbol: SA1831
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2069354..2069563
- length: 210
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124723 NCBI
- RefSeq: NP_375132 NCBI
- BioCyc: see SA_RS10505
- MicrobesOnline: 104158 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATAATGAACAAAAAGAAGTAATAGAACACGTGGTTTATCAACTTGAGTTAAGTGTC
GTGAATAATTTGGAAAGTTATGAACACACAGAATATGTTAATGGTATTGAAGTGGTTTCA
GAGATCAGTCGTGAAAAGCACTTAGAATTGATAATGAAATGGTGCGCACAAGAATTAAAG
AATAATTTTCAATTAGAGAAAGGAGAATAA60
120
180
210
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1831 [new locus tag: SA_RS10505 ]
- symbol: SA1831
- description: hypothetical protein
- length: 69
- theoretical pI: 4.37185
- theoretical MW: 8206.17
- GRAVY: -0.601449
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Hypothetical SAV0788 homolog in superantigen-encoding pathogenicity islands SaPI
- PFAM: no clan defined DUF7166; Domain of unknown function (DUF7166) (PF23767; HMM-score: 111.4)and 2 moreOB (CL0021) RecG_wedge; RecG wedge domain (PF17191; HMM-score: 13.3)no clan defined TRI4_N; TRI4 N-terminal (PF23135; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8407
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.1586
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00493
- TAT(Tat/SPI): 0.00017
- LIPO(Sec/SPII): 0.000719
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNEQKEVIEHVVYQLELSVVNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA1828 < SA1829 < SA1830 < SA1831
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]