From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1871 [new locus tag: SA_RS10760 ]
  • pan locus tag?: SAUPAN005335000
  • symbol: rsbV
  • pan gene symbol?: rsbV
  • synonym:
  • product: anti-sigmaB factor antagonist

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1871 [new locus tag: SA_RS10760 ]
  • symbol: rsbV
  • product: anti-sigmaB factor antagonist
  • replicon: chromosome
  • strand: -
  • coordinates: 2119376..2119702
  • length: 327
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATCTTAATATAGAAACAACCACTCAAGATAAATTTTACGAAGTTAAAGTCGGTGGA
    GAATTAGATGTTTATACTGTGCCTGAATTAGAAGAGGTTTTAACACCTATGAGACAAGAT
    GGAACTCGTGATATTTATGTTAATTTAGAAAATGTGAGTTATATGGATTCGACAGGTTTA
    GGTTTATTCGTAGGTACATTAAAAGCATTAAACCAAAATGATAAAGAACTATACATTTTA
    GGTGTGTCAGATCGTATCGGTAGACTATTTGAAATTACTGGTCTTAAGGATTTAATGCAT
    GTTAATGAAGGAACGGAGGTCGAATAA
    60
    120
    180
    240
    300
    327

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1871 [new locus tag: SA_RS10760 ]
  • symbol: RsbV
  • description: anti-sigmaB factor antagonist
  • length: 108
  • theoretical pI: 4.04316
  • theoretical MW: 12204.7
  • GRAVY: -0.269444

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions Protein interactions anti-anti-sigma factor (TIGR00377; HMM-score: 117.5)
    and 2 more
    Cellular processes Cellular processes Sporulation and germination anti-sigma F factor antagonist (TIGR02886; HMM-score: 66.1)
    Signal transduction Regulatory functions Protein interactions anti-sigma F factor antagonist (TIGR02886; HMM-score: 66.1)
  • TheSEED  :
    • Anti-sigma B factor antagonist RsbV
    Stress Response Stress Response - no subcategory SigmaB stress responce regulation  anti sigma b factor antagonist RsbV
    and 1 more
    Stress Response Stress Response - no subcategory SigmaB stress responce regulation  anti-sigma F factor antagonist (spoIIAA-2)
  • PFAM:
    STAS (CL0502) STAS; STAS domain (PF01740; HMM-score: 50.1)
    STAS_2; STAS domain (PF13466; HMM-score: 43.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005334
    • TAT(Tat/SPI): 0.000475
    • LIPO(Sec/SPII): 0.000573
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNLNIETTTQDKFYEVKVGGELDVYTVPELEEVLTPMRQDGTRDIYVNLENVSYMDSTGLGLFVGTLKALNQNDKELYILGVSDRIGRLFEITGLKDLMHVNEGTEVE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]