From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA1940 [new locus tag: SA_RS11145 ]
  • pan locus tag?: SAUPAN005435000
  • symbol: deoD
  • pan gene symbol?: deoD
  • synonym:
  • product: purine nucleoside phosphorylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA1940 [new locus tag: SA_RS11145 ]
  • symbol: deoD
  • product: purine nucleoside phosphorylase
  • replicon: chromosome
  • strand: +
  • coordinates: 2189902..2190612
  • length: 711
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGACAAAAGGTACACCACATATTCAACCAAATGGAGTAAAAATTGCTAAAACAGTATTA
    ATGCCTGGCGATCCGCTACGCGCAAAATATATTGCTGATAATTTTTTAGAAAATGTTGAA
    CAATTTAACGATGTACGTAACATGTTTGGTTACACTGGTACATATAAAGGTAAAGAAGTT
    TCTGTAATGGGTTCTGGTATGGGTATTCCAAGTATTGGTATTTACTCATATGAGTTATAC
    AACTTCTTTGATGTAGATACAATCATTCGTATCGGTTCTTGTGGCGCATTACAAGAAAAT
    GTTAACTTATACGATGTTATTATTGCACAAGCTGCATCAACTAATTCAAATTATGTAGAT
    CAATACAATATTCCAGGTCATTTCGCGCCTATCGCTGACTTCGAGTTAGTAACTAAAGCT
    AAAAATGTCGCTGACCAAATCGGTGCTACTACACACGTAGGTAACGTATTATCTTCTGAT
    ACATTTTACAATGCCGATCCAACATTCAATGATGCTTGGAAAAAAATGGGTATTTTAGGT
    ATCGAAATGGAATCAGCTGGTTTATATTTAAATGCGATTCATGCTGGTAAAAAAGCACTT
    GGTATTTTCACAGTAAGTGATCATATTTTACGTGACGAAGCTACTACACCTGAAGAACGT
    CAAAATTCATTTACACAAATGATGGAAATCGCTTTAGAAATCGCAGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    711

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA1940 [new locus tag: SA_RS11145 ]
  • symbol: DeoD
  • description: purine nucleoside phosphorylase
  • length: 236
  • theoretical pI: 4.57428
  • theoretical MW: 25908.1
  • GRAVY: -0.12839

Function[edit | edit source]

  • reaction:
    EC 2.4.2.1?  ExPASy
    Purine-nucleoside phosphorylase Purine nucleoside + phosphate = purine + alpha-D-ribose 1-phosphate Purine deoxynucleoside + phosphate = purine + 2'-deoxy-alpha-D-ribose 1-phosphate
  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides purine nucleoside phosphorylase (TIGR00107; EC 2.4.2.1; HMM-score: 309.6)
    and 7 more
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine phosphorylase (TIGR01718; EC 2.4.2.3; HMM-score: 120.1)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 37)
    Metabolism Central intermediary metabolism Other MTA/SAH nucleosidase (TIGR01704; EC 3.2.2.16,3.2.2.9; HMM-score: 37)
    putative AMP nucleosidase (TIGR01721; HMM-score: 29.8)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine phosphorylase (TIGR01719; EC 2.4.2.3; HMM-score: 26.3)
    futalosine hydrolase (TIGR03664; EC 3.2.2.26; HMM-score: 24)
    hopanoid-associated phosphorylase (TIGR03468; HMM-score: 22.4)
  • TheSEED:  
    Carbohydrates Monosaccharides Deoxyribose and Deoxynucleoside Catabolism  Purine nucleoside phosphorylase (EC 2.4.2.1)
    and 2 more
    Nucleosides and Nucleotides Purines Purine conversions  Purine nucleoside phosphorylase (EC 2.4.2.1)
    Pyrimidines pyrimidine conversions  Purine nucleoside phosphorylase (EC 2.4.2.1)
  • PFAM:
    PUP (CL0408) PNP_UDP_1; Phosphorylase superfamily (PF01048; HMM-score: 128.7)
    and 1 more
    no clan defined Cu; Cupiennin (PF17563; HMM-score: 12.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:
    SA0627hypothetical protein  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013157
    • TAT(Tat/SPI): 0.000503
    • LIPO(Sec/SPII): 0.000946
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKGTPHIQPNGVKIAKTVLMPGDPLRAKYIADNFLENVEQFNDVRNMFGYTGTYKGKEVSVMGSGMGIPSIGIYSYELYNFFDVDTIIRIGSCGALQENVNLYDVIIAQAASTNSNYVDQYNIPGHFAPIADFELVTKAKNVADQIGATTHVGNVLSSDTFYNADPTFNDAWKKMGILGIEMESAGLYLNAIHAGKKALGIFTVSDHILRDEATTPEERQNSFTQMMEIALEIAE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • deoD no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]