From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2076 [new locus tag: SA_RS11935 ]
  • pan locus tag?: SAUPAN005743000
  • symbol: SA2076
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2076 [new locus tag: SA_RS11935 ]
  • symbol: SA2076
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2336341..2337111
  • length: 771
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCTAGTATAAGTATGTCAGATATATATTGTAACGGCACTATATTTGAAAATGACGAC
    GAGCAGTTAATTTATTTAACGCCTTCTTTTCCACAACGATACACAAGCAACACATGGATA
    TATAAAAAGACGCCTACCCAAGAGCGATGGCTGAAAGACTTAGAACGTCAACATCAATTA
    CATACAAATCAAGGTTCAAATCATTATGCGTTTAGTTTCCCGGAAAATGAACAACTTGAT
    AATCATTGGATGGCTATGTTTAAAGATATGAATTTTGAACTAGGTATTATGGAATTGTAT
    GCCATAGAAAGTGATGCGCTTGCTAATTTGCCGCGTAACTCTGACGTTGAAATTGCCGTC
    GTTGACGAGTCGCATATAGATGCCTATTTAAAAGTTGCATATCAGTTTAGTCTGCCATTT
    GGAAAAGACTATGCAGATGCACATGAAGAAATGGTAAGGGAACATTATCAAAAAGATGTG
    ATTAAACGCTTAGTAGCTTATTTAAATAATGAACCTATTGGCGTTGTAGATGTCATTGAA
    AGTGAAAATTACATTGAATTAGATGGATTTGGTGTATTAGAACAATTTCGACACCAAGGA
    ATTGGATCTACAATTCAATCGTTGATAGGTGAATACGCCATATCAAAAAATCACAAACCA
    ATCATATTAGTTACAGATGGTGAAGATACAGCAAAAGATATGTATGCAAAGCAAGGTTAT
    GTCTATCAATCGTTTTGTTATCAAATATTAAAAGAAGATATTGGAAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2076 [new locus tag: SA_RS11935 ]
  • symbol: SA2076
  • description: hypothetical protein
  • length: 256
  • theoretical pI: 4.39872
  • theoretical MW: 29684
  • GRAVY: -0.479688

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 16.2)
  • TheSEED:  
    Acetyltransferase
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 30.9)
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 30)
    Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 28.6)
    and 2 more
    FR47; FR47-like protein (PF08445; HMM-score: 20.1)
    no clan defined XRCC4; DNA double-strand break repair and V(D)J recombination protein XRCC4 (PF06632; HMM-score: 13.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006522
    • TAT(Tat/SPI): 0.00023
    • LIPO(Sec/SPII): 0.001467
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MASISMSDIYCNGTIFENDDEQLIYLTPSFPQRYTSNTWIYKKTPTQERWLKDLERQHQLHTNQGSNHYAFSFPENEQLDNHWMAMFKDMNFELGIMELYAIESDALANLPRNSDVEIAVVDESHIDAYLKVAYQFSLPFGKDYADAHEEMVREHYQKDVIKRLVAYLNNEPIGVVDVIESENYIELDGFGVLEQFRHQGIGSTIQSLIGEYAISKNHKPIILVTDGEDTAKDMYAKQGYVYQSFCYQILKEDIGN

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: BirA* (repression) regulon
    BirA(TF)important in Biotin biosynthesis; RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]