From AureoWiki
Jump to: navigation, search

NCBI: 26-AUG-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2356 [new locus tag: SA_RS13495 ]
  • pan locus tag?: SAUPAN006235000
  • symbol: isaA
  • pan gene symbol?: isaA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SA2356 [new locus tag: SA_RS13495 ]
  • symbol: isaA
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2648126..2648827
  • length: 702
  • essential: no DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAAAGACAATTATGGCATCATCATTAGCAGTGGCATTAGGTGTAACAGGTTACGCA
    GCAGGTACAGGACATCAAGCACACGCTGCTGAAGTAAACGTTGATCAAGCACACTTAGTT
    GACTTAGCGCATAATCACCAAGATCAATTAAATGCAGCTCCAATCAAAGATGGTGCATAT
    GACATCCACTTTGTAAAAGATGGTTTCCAATATAACTTTACTTCAAATGGTACTACATGG
    TCATGGAGCTATGAAGCAGCTAATGGTCAAACTGCTGGTTTCTCAAACGTTGCAGGTGCA
    GACTACACTACTTCATACAACCAAGGTTCAGATGTACAATCAGTAAGCTACAATGCACAA
    TCAAGTAACTCAAACGTTGAAGCTGTTTCAGCTCCAACTTACCATAACTACAGCACTTCA
    ACTACTTCAAGTTCAGTGAGATTAAGCAATGGTAATACTGCAGGTGCTACTGGTTCATCA
    GCAGCTCAAATCATGGCTCAACGTACTGGTGTTTCAGCTTCTACATGGGCTGCAATCATC
    GCTCGTGAATCAAATGGTCAAGTAAATGCTTACAACCCATCAGGTGCTTCAGGTTTATTC
    CAAACTATGCCAGGTTGGGGTCCGACAAACACTGTTGACCAACAAATCAACGCAGCTGTT
    AAAGCATACAAAGCACAAGGTTTAGGTGCTTGGGGATTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    702

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SA2356 [new locus tag: SA_RS13495 ]
  • symbol: IsaA
  • description: hypothetical protein
  • length: 233
  • theoretical pI: 6.38594
  • theoretical MW: 24204
  • GRAVY: -0.338197

Function[edit source | edit]

  • reaction:
    EC 3.2.-.-?  ExPASy
  • TIGRFAM:
  • TheSEED:  
    Immunodominant staphylococcal antigen A precursor
  • PFAM:
    Lysozyme (CL0037) SLT; Transglycosylase SLT domain (PF01464; HMM-score: 28.3)
    and 2 more
    Transglycosylas; Transglycosylase-like domain (PF06737; HMM-score: 21.9)
    no clan definedDUF945; Bacterial protein of unknown function (DUF945) (PF06097; HMM-score: 15.9)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP: N-terminally anchored (with CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: GTGHQAHA
  • SignalP: Signal peptide SP(Sec/SPI) length 29 aa
    • SP(Sec/SPI): 0.994875
    • TAT(Tat/SPI): 0.002931
    • LIPO(Sec/SPII): 0.001546
    • Cleavage Site: CS pos: 29-30. AHA-AE. Pr: 0.9855
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQSSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • isaA no polycistronic organisation predicted

Regulation[edit source | edit]

  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Alexander Scherl, Patrice François, Manuela Bento, Jacques M Deshusses, Yvan Charbonnier, Véronique Converset, Antoine Huyghe, Nadia Walter, Christine Hoogland, Ron D Appel, Jean-Charles Sanchez, Catherine G Zimmermann-Ivol, Garry L Corthals, Denis F Hochstrasser, Jacques Schrenzel
Correlation of proteomic and transcriptomic profiles of Staphylococcus aureus during the post-exponential phase of growth.
J. Microbiol. Methods: 2005, 60(2);247-57
[PubMed:15590099] [WorldCat.org] [DOI] (P p)