Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2401
- pan locus tag?: SAUPAN006307000
- symbol: SA2401
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2401
- symbol: SA2401
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2690964..2691212
- length: 249
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125330 NCBI
- RefSeq: NP_375727 NCBI
- BioCyc:
- MicrobesOnline: 104753 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241CTGCATCCAAGAAAAACATTACAATTACCTTTAATATTGAAAATTATTTTGAATCTTGCA
CTTATAGGTATTGTAATTATCGTTCTAACACATACTGAGTTTCAACTTAATGCCGGTGAT
AGTAATGTGTTTTTATTAAACTGGGATATTCGAGGTTTAACATCTTATATTTTCTCATTC
TTAATACTGGTTGCGCTTGTTTCTAAACTAATTTTAATATTTATAACTAGACGACAAAGA
ACATCATAA60
120
180
240
249
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2401
- symbol: SA2401
- description: hypothetical protein
- length: 82
- theoretical pI: 11.542
- theoretical MW: 9385.33
- GRAVY: 0.914634
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: FIG01108265: hypothetical protein
- PFAM: no clan defined DUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 19.6)and 1 moreDUF3671; Protein of unknown function (PF12420; HMM-score: 10.7)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.017791
- TAT(Tat/SPI): 0.000314
- LIPO(Sec/SPII): 0.010123
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHPRKTLQLPLILKIILNLALIGIVIIVLTHTEFQLNAGDSNVFLLNWDIRGLTSYIFSFLILVALVSKLILIFITRRQRTS
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SA2401 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]