From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0048 [new locus tag: SACOL_RS00255 ]
  • pan locus tag?: SAUPAN000111000
  • symbol: SACOL0048
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0048 [new locus tag: SACOL_RS00255 ]
  • symbol: SACOL0048
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 55981..56241
  • length: 261
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGGAATATAATAAAAAGATGATTAATCGTATTCATCGCATACAAGGACAGCTTAATGGA
    GTCATTAAAATGATGGAGGAAGAAAAAAATTGTAAAGACGTCATTAGTCAATTAAGTGCA
    TCTAAAAGTTCTATTCAACGTTTAATGGGTATTATTATTAGCGAGAACTTAGTAGAATGC
    GTCAAAATGTCTGAAGAAAATAGTGAAGATTCTCAGGCACTAATTAATGAAGCTGTTGAA
    TTATTAATAAAAAGTAAATGA
    60
    120
    180
    240
    261

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0048 [new locus tag: SACOL_RS00255 ]
  • symbol: SACOL0048
  • description: hypothetical protein
  • length: 86
  • theoretical pI: 5.88616
  • theoretical MW: 9811.4
  • GRAVY: -0.359302

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG007303: uncharacterized protein
  • PFAM:
    no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 79.9)
    and 2 more
    TcdB_N; TcdB toxin N-terminal helical domain (PF12918; HMM-score: 19)
    Laminin_I; Laminin Domain I (PF06008; HMM-score: 13.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003664
    • TAT(Tat/SPI): 0.000374
    • LIPO(Sec/SPII): 0.000404
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MEYNKKMINRIHRIQGQLNGVIKMMEEEKNCKDVISQLSASKSSIQRLMGIIISENLVECVKMSEENSEDSQALINEAVELLIKSK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]