Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0045 [new locus tag: SA_RS00370 ]
- pan locus tag?: SAUPAN000111000
- symbol: SA0045
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0045 [new locus tag: SA_RS00370 ]
- symbol: SA0045
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 53563..53823
- length: 261
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1122819 NCBI
- RefSeq: NP_373285 NCBI
- BioCyc: see SA_RS00370
- MicrobesOnline: 102311 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGACTTATGATAAAAAAATGATTAATCGTATAAATAGAATACAAGGTCAATTAAATGGT
GTCGTAAAAATGATGGAAGAAGAAAAAGATTGCAAAGATATAATTACGCAACTTAGTGCA
TCTAAAGGTTCTATACAACGTTTAATGGGGATTATAATTAGTGAAAATTTAATAGAATGC
GTTAAAACAGCAGAAGAAAATAATGAAAGTTCTCAAGAATTAATTAATGAAGCAGTTAAT
TTATTAGTTAAAAGTAAATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0045 [new locus tag: SA_RS00370 ]
- symbol: SA0045
- description: hypothetical protein
- length: 86
- theoretical pI: 5.15191
- theoretical MW: 9742.27
- GRAVY: -0.386046
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Uncharacterized protein YrkD
- PFAM: no clan defined Trns_repr_metal; Metal-sensitive transcriptional repressor (PF02583; HMM-score: 85.6)and 5 moreMet_repress (CL0057) Antitox_RHH; Antitoxin-like ribbon-helix-helix (PF20605; HMM-score: 15.2)no clan defined Laminin_I; Laminin Domain I (PF06008; HMM-score: 14.7)HTH (CL0123) HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 14.2)Dimerisation; Plant O-methyltransferase dimerisation domain (PF08100; HMM-score: 13.8)Met_repress (CL0057) DUF7557; Family of unknown function (DUF7557) (PF24434; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9566
- Cytoplasmic Membrane Score: 0.0028
- Cell wall & surface Score: 0.0055
- Extracellular Score: 0.0351
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002577
- TAT(Tat/SPI): 0.000642
- LIPO(Sec/SPII): 0.000409
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTYDKKMINRINRIQGQLNGVVKMMEEEKDCKDIITQLSASKGSIQRLMGIIISENLIECVKTAEENNESSQELINEAVNLLVKSK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.