Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0118 [new locus tag: SACOL_RS00590 ]
- pan locus tag?: SAUPAN000942000
- symbol: sodA1
- pan gene symbol?: sodM
- synonym:
- product: superoxide dismutase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0118 [new locus tag: SACOL_RS00590 ]
- symbol: sodA1
- product: superoxide dismutase
- replicon: chromosome
- strand: +
- coordinates: 133399..133998
- length: 600
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236826 NCBI
- RefSeq: YP_185022 NCBI
- BioCyc: see SACOL_RS00590
- MicrobesOnline: 911597 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGGCATTTAAATTACCAAATTTACCATATGCATATGATGCATTGGAACCATATATAGAT
CAAAGAACAATGGAGTTTCATCACGACAAACATCACAATACGTACGTGACGAAATTAAAC
GCAACAGTTGAAGGAACAGAGTTAGAGCATCAATCACTAGCGGATATGATTGCTAACTTA
GACAAGGTACCGGAAGCGATGAGGATGTCAGTCCGTAATAATGGCGGTGGTCATTTTAAC
CATTCATTATTCTGGGAAATACTATCACCTAATTCTGAAGAAAAAGGTGGCGTAATAGAT
GACATCAAAGCGCAGTGGGGCACTTTAGATGAATTTAAAAATGAATTTGCAAATAAAGCA
ACAACATTATTTGGATCAGGTTGGACTTGGTTAGTTGTTAATGATGGCAAATTAGAAATT
GTGACAACGCCAAACCAAGATAATCCATTAACAGAAGGCAAAACACCAATCTTACTATTT
GATGTTTGGGAGCATGCCTACTATCTGAAATATCAAAATAAACGTCCAGACTATATGACT
GCATTTTGGAACATTGTTAACTGGAAAAAAGTTGATGAATTATACCAAGCAGCAAAATAA60
120
180
240
300
360
420
480
540
600
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0118 [new locus tag: SACOL_RS00590 ]
- symbol: SodA1
- description: superoxide dismutase
- length: 199
- theoretical pI: 5.28358
- theoretical MW: 23040.8
- GRAVY: -0.583417
⊟Function[edit | edit source]
- reaction: EC 1.15.1.1? ExPASySuperoxide dismutase 2 superoxide + 2 H+ = O2 + H2O2
- TIGRFAM:
- TheSEED :
- Superoxide dismutase [Fe] (EC 1.15.1.1)
- Superoxide dismutase [Mn] (EC 1.15.1.1)
Nitrogen Metabolism Nitrogen Metabolism - no subcategory Nitric oxide synthase Manganese superoxide dismutase (EC 1.15.1.1)and 5 more - PFAM: no clan defined Sod_Fe_C; Iron/manganese superoxide dismutases, C-terminal domain (PF02777; HMM-score: 141)and 1 moreSod_Fe_N; Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081; HMM-score: 111.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Fe2+, Mn2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.09
- Cellwall Score: 0.18
- Extracellular Score: 9.72
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9277
- Cytoplasmic Membrane Score: 0.0004
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0718
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002595
- TAT(Tat/SPI): 0.000228
- LIPO(Sec/SPII): 0.00037
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKATTLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNWKKVDELYQAAK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 400 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: CodY (repression) regulon
CodY (TF) important in Amino acid metabolism; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 21.23 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Michelle Wright Valderas, Joshua W Gatson, Natalie Wreyford, Mark E Hart
The superoxide dismutase gene sodM is unique to Staphylococcus aureus: absence of sodM in coagulase-negative staphylococci.
J Bacteriol: 2002, 184(9);2465-72
[PubMed:11948161] [WorldCat.org] [DOI] (P p)Michail H Karavolos, Malcolm J Horsburgh, Eileen Ingham, Simon J Foster
Role and regulation of the superoxide dismutases of Staphylococcus aureus.
Microbiology (Reading): 2003, 149(Pt 10);2749-2758
[PubMed:14523108] [WorldCat.org] [DOI] (P p)
